Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QRD3

Protein Details
Accession E3QRD3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-36AESARRSEQKKRREKDLRPTTPTQKHydrophilic
NLS Segment(s)
PositionSequence
21-24KKRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAGPASMSSANAESARRSEQKKRREKDLRPTTPTQKAEAQMTSARLVGITHDSEPEPWQTVSADIKTLPDAAVIYTRHHGFFTVPPPRVIRNINQRHSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.22
3 0.26
4 0.31
5 0.4
6 0.47
7 0.57
8 0.66
9 0.68
10 0.73
11 0.77
12 0.8
13 0.81
14 0.84
15 0.82
16 0.79
17 0.8
18 0.76
19 0.75
20 0.68
21 0.6
22 0.53
23 0.46
24 0.42
25 0.35
26 0.31
27 0.23
28 0.23
29 0.2
30 0.16
31 0.14
32 0.11
33 0.1
34 0.09
35 0.09
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.11
42 0.11
43 0.11
44 0.1
45 0.1
46 0.09
47 0.11
48 0.13
49 0.12
50 0.12
51 0.1
52 0.11
53 0.11
54 0.11
55 0.09
56 0.07
57 0.07
58 0.07
59 0.11
60 0.11
61 0.13
62 0.16
63 0.18
64 0.18
65 0.18
66 0.18
67 0.16
68 0.2
69 0.27
70 0.32
71 0.33
72 0.35
73 0.38
74 0.4
75 0.43
76 0.43
77 0.43
78 0.45
79 0.54
80 0.59