Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q2R0

Protein Details
Accession E3Q2R0    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
192-212AVEWVRSRVKWNKESRPPVMRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, cyto 10, cyto_mito 9.999, nucl 8.5, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR024156  Small_GTPase_ARF  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0042175  C:nuclear outer membrane-endoplasmic reticulum membrane network  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0043001  P:Golgi to plasma membrane protein transport  
GO:0006886  P:intracellular protein transport  
GO:0034067  P:protein localization to Golgi apparatus  
GO:0034976  P:response to endoplasmic reticulum stress  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
Amino Acid Sequences MYHLAKGLYLLATSKEEYSVILLGLDNAGKTTFHEQVKSLFLPGNPDPKLKTVPTVGQNVSTITLPDMYLKIWDVGGQHSLRRLWQSYYSSAHAIVFIIDSTDIGNGTLENNSSGRLEECRLVLEDVLQHSETEGVPVLVLANKQDREDCVEVVRIKEGLVKKVFEGEKASSIRDSRVLPVSALTGTGVKEAVEWVRSRVKWNKESRPPVMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.15
6 0.13
7 0.1
8 0.1
9 0.09
10 0.08
11 0.09
12 0.09
13 0.07
14 0.07
15 0.07
16 0.07
17 0.09
18 0.14
19 0.19
20 0.21
21 0.23
22 0.23
23 0.26
24 0.31
25 0.29
26 0.26
27 0.22
28 0.2
29 0.25
30 0.27
31 0.32
32 0.29
33 0.3
34 0.3
35 0.31
36 0.35
37 0.29
38 0.3
39 0.25
40 0.3
41 0.32
42 0.36
43 0.34
44 0.31
45 0.31
46 0.28
47 0.25
48 0.19
49 0.15
50 0.1
51 0.1
52 0.08
53 0.09
54 0.08
55 0.07
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.13
64 0.13
65 0.13
66 0.15
67 0.15
68 0.16
69 0.18
70 0.18
71 0.16
72 0.21
73 0.23
74 0.24
75 0.27
76 0.27
77 0.25
78 0.23
79 0.21
80 0.16
81 0.13
82 0.1
83 0.07
84 0.05
85 0.04
86 0.04
87 0.03
88 0.04
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.1
108 0.11
109 0.1
110 0.1
111 0.09
112 0.09
113 0.09
114 0.11
115 0.1
116 0.09
117 0.09
118 0.1
119 0.09
120 0.08
121 0.08
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.11
130 0.12
131 0.13
132 0.14
133 0.14
134 0.2
135 0.22
136 0.21
137 0.18
138 0.23
139 0.23
140 0.23
141 0.23
142 0.17
143 0.15
144 0.2
145 0.21
146 0.22
147 0.24
148 0.24
149 0.23
150 0.3
151 0.31
152 0.27
153 0.29
154 0.25
155 0.28
156 0.29
157 0.3
158 0.26
159 0.27
160 0.26
161 0.26
162 0.25
163 0.22
164 0.26
165 0.26
166 0.23
167 0.22
168 0.22
169 0.18
170 0.17
171 0.14
172 0.1
173 0.1
174 0.1
175 0.1
176 0.08
177 0.08
178 0.1
179 0.11
180 0.13
181 0.14
182 0.18
183 0.26
184 0.27
185 0.35
186 0.42
187 0.49
188 0.55
189 0.65
190 0.71
191 0.74
192 0.82