Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QMX5

Protein Details
Accession E3QMX5    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-189TGNSNNNNSKKKKNTDKNSKNETKEGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 7.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Amino Acid Sequences MGVSPGPQLGAGQPAVPAAVDPRSPEPPSVLGDSSVSSNRGNDAVISQPSTDAASRQQPAEGVQGKEKDAAADDDADAYESRHVHTVYEAIAPHFSSTRYKPWPLVASFLLSLPPGSVGLDAGCGNGKYIGVNPALYIIASDRSANLVSLARSYQPPHFEAGGTGNSNNNNSKKKKNTDKNSKNETKEGAAATSESASAATRAPNNHSTQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.08
6 0.1
7 0.11
8 0.14
9 0.18
10 0.23
11 0.25
12 0.26
13 0.26
14 0.26
15 0.28
16 0.29
17 0.25
18 0.21
19 0.2
20 0.2
21 0.2
22 0.19
23 0.17
24 0.14
25 0.14
26 0.14
27 0.14
28 0.13
29 0.11
30 0.11
31 0.14
32 0.15
33 0.15
34 0.14
35 0.14
36 0.14
37 0.15
38 0.14
39 0.11
40 0.13
41 0.18
42 0.19
43 0.19
44 0.19
45 0.18
46 0.2
47 0.26
48 0.27
49 0.23
50 0.26
51 0.27
52 0.27
53 0.28
54 0.26
55 0.19
56 0.15
57 0.15
58 0.12
59 0.11
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.1
70 0.11
71 0.1
72 0.1
73 0.11
74 0.1
75 0.12
76 0.11
77 0.09
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.1
84 0.13
85 0.19
86 0.22
87 0.24
88 0.24
89 0.27
90 0.31
91 0.28
92 0.29
93 0.22
94 0.2
95 0.19
96 0.17
97 0.14
98 0.1
99 0.09
100 0.06
101 0.06
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.05
116 0.06
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.09
123 0.09
124 0.08
125 0.06
126 0.07
127 0.07
128 0.07
129 0.06
130 0.08
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1
137 0.11
138 0.11
139 0.12
140 0.15
141 0.18
142 0.2
143 0.2
144 0.22
145 0.22
146 0.21
147 0.2
148 0.21
149 0.2
150 0.18
151 0.18
152 0.17
153 0.18
154 0.21
155 0.26
156 0.3
157 0.35
158 0.39
159 0.48
160 0.55
161 0.64
162 0.72
163 0.77
164 0.82
165 0.85
166 0.9
167 0.91
168 0.92
169 0.91
170 0.85
171 0.79
172 0.71
173 0.63
174 0.57
175 0.48
176 0.38
177 0.3
178 0.25
179 0.21
180 0.17
181 0.14
182 0.1
183 0.09
184 0.08
185 0.09
186 0.09
187 0.12
188 0.16
189 0.18
190 0.25
191 0.31