Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QG89

Protein Details
Accession E3QG89   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-104VGAGQGSSRRCRRRRCEEAAAMGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008401  Apc13  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF05839  Apc13p  
Amino Acid Sequences MHRARDADLFEDFCKEKLPDDEVYVPPQHQPINPEDEDDVVPDQHAAFGITKATQRQREAAWKDLGLAGLMNRGPPAAGRVGAGQGSSRRCRRRRCEEAAAMGLMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.21
5 0.25
6 0.22
7 0.26
8 0.31
9 0.29
10 0.32
11 0.31
12 0.27
13 0.25
14 0.26
15 0.23
16 0.19
17 0.21
18 0.2
19 0.26
20 0.25
21 0.25
22 0.23
23 0.22
24 0.21
25 0.19
26 0.17
27 0.09
28 0.09
29 0.08
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.11
40 0.16
41 0.19
42 0.2
43 0.21
44 0.23
45 0.31
46 0.34
47 0.35
48 0.32
49 0.28
50 0.28
51 0.27
52 0.25
53 0.16
54 0.12
55 0.07
56 0.08
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.11
69 0.11
70 0.11
71 0.11
72 0.14
73 0.2
74 0.28
75 0.36
76 0.45
77 0.52
78 0.63
79 0.71
80 0.77
81 0.81
82 0.82
83 0.84
84 0.82
85 0.81
86 0.74