Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QSG5

Protein Details
Accession E3QSG5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
116-140SNYYHYSSMKKQKTRKRQRKSVHWAHydrophilic
NLS Segment(s)
PositionSequence
125-135KKQKTRKRQRK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRVKRDADYDELDERPRRKYQRDASGLRVSVAADQTEVGGPEEPSSESVFRLAWLFVEGWRRKLQKAGDTVERSRWEWELGGASAVSMHSNASSLTLGEILADARKRAHGGQGNHSNYYHYSSMKKQKTRKRQRKSVHWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.42
4 0.45
5 0.48
6 0.57
7 0.61
8 0.66
9 0.73
10 0.72
11 0.71
12 0.71
13 0.65
14 0.55
15 0.46
16 0.36
17 0.29
18 0.25
19 0.17
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.09
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.08
40 0.07
41 0.07
42 0.07
43 0.09
44 0.18
45 0.18
46 0.2
47 0.26
48 0.28
49 0.27
50 0.32
51 0.33
52 0.29
53 0.34
54 0.34
55 0.36
56 0.38
57 0.39
58 0.39
59 0.37
60 0.33
61 0.29
62 0.26
63 0.19
64 0.15
65 0.15
66 0.12
67 0.1
68 0.09
69 0.08
70 0.07
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.03
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.07
89 0.08
90 0.08
91 0.09
92 0.1
93 0.12
94 0.13
95 0.21
96 0.25
97 0.29
98 0.38
99 0.48
100 0.5
101 0.5
102 0.5
103 0.43
104 0.37
105 0.38
106 0.31
107 0.23
108 0.25
109 0.32
110 0.42
111 0.5
112 0.58
113 0.62
114 0.71
115 0.8
116 0.87
117 0.89
118 0.89
119 0.91
120 0.93