Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QQB8

Protein Details
Accession E3QQB8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-74LATVPLRRPPRPRLRRAIRSLWRHydrophilic
NLS Segment(s)
PositionSequence
58-71RRPPRPRLRRAIRS
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPGIKFIPEERLSGHQRAPPEPVEPLGHVRFSKGRAASTFHATDDASRSQELATVPLRRPPRPRLRRAIRSLWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.34
4 0.35
5 0.35
6 0.3
7 0.27
8 0.24
9 0.23
10 0.22
11 0.2
12 0.24
13 0.21
14 0.22
15 0.2
16 0.21
17 0.21
18 0.21
19 0.24
20 0.2
21 0.2
22 0.19
23 0.23
24 0.23
25 0.25
26 0.24
27 0.19
28 0.19
29 0.18
30 0.17
31 0.16
32 0.16
33 0.13
34 0.12
35 0.13
36 0.11
37 0.14
38 0.13
39 0.14
40 0.16
41 0.19
42 0.2
43 0.26
44 0.32
45 0.35
46 0.41
47 0.48
48 0.56
49 0.62
50 0.7
51 0.75
52 0.81
53 0.86
54 0.87