Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QGJ6

Protein Details
Accession E3QGJ6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-71HFATLKPEQQKKKEPRKGAKGGKKBasic
NLS Segment(s)
PositionSequence
57-71QKKKEPRKGAKGGKK
Subcellular Location(s) cyto 7.5, extr 6, cyto_nucl 5.5, mito 4, E.R. 3, nucl 2.5, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFRSIGATPEAVAVLNDQPILFTILLVALLAIILECVLLWYIHFATLKPEQQKKKEPRKGAKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.09
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.03
32 0.05
33 0.05
34 0.07
35 0.08
36 0.08
37 0.12
38 0.18
39 0.24
40 0.3
41 0.39
42 0.45
43 0.53
44 0.63
45 0.7
46 0.76
47 0.8
48 0.83
49 0.85
50 0.87
51 0.9