Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q4N5

Protein Details
Accession E3Q4N5   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-77DRFWLLEWKRGRKKKKKKEKKDRKKRQKKIAEPRPAIABasic
NLS Segment(s)
PositionSequence
48-73KRGRKKKKKKEKKDRKKRQKKIAEPR
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 10, cyto_nucl 9.666, cyto 5
Family & Domain DBs
Amino Acid Sequences MRDWARESSILWGGRGAGKPTRQRSKVISHRTSSINPQADRFWLLEWKRGRKKKKKKEKKDRKKRQKKIAEPRPAIAVGCRLGPSFGRVRESVSTTTKFCLMAHLTTSPGRGKGHMLPFCRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.24
5 0.3
6 0.39
7 0.48
8 0.56
9 0.54
10 0.56
11 0.58
12 0.63
13 0.66
14 0.68
15 0.65
16 0.58
17 0.6
18 0.59
19 0.56
20 0.52
21 0.5
22 0.47
23 0.41
24 0.4
25 0.36
26 0.34
27 0.33
28 0.27
29 0.2
30 0.2
31 0.2
32 0.25
33 0.3
34 0.38
35 0.46
36 0.54
37 0.63
38 0.67
39 0.78
40 0.82
41 0.88
42 0.9
43 0.92
44 0.95
45 0.96
46 0.97
47 0.97
48 0.97
49 0.97
50 0.97
51 0.96
52 0.95
53 0.94
54 0.93
55 0.93
56 0.92
57 0.91
58 0.82
59 0.73
60 0.65
61 0.55
62 0.44
63 0.33
64 0.25
65 0.15
66 0.14
67 0.13
68 0.1
69 0.11
70 0.11
71 0.14
72 0.16
73 0.17
74 0.2
75 0.2
76 0.23
77 0.25
78 0.28
79 0.29
80 0.29
81 0.3
82 0.28
83 0.29
84 0.27
85 0.25
86 0.21
87 0.23
88 0.21
89 0.2
90 0.22
91 0.21
92 0.23
93 0.23
94 0.26
95 0.23
96 0.23
97 0.23
98 0.21
99 0.25
100 0.3
101 0.39
102 0.42