Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QDQ9

Protein Details
Accession E3QDQ9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-88VHNEASKSSRPKRRTRKKKAKDGRADIRRVPNBasic
NLS Segment(s)
PositionSequence
63-82KSSRPKRRTRKKKAKDGRAD
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSSTPALDSASTAAHPPESEVGEVPGQTFQFARPKTFIGRLASSFVPDVGPIVPLSVHNEASKSSRPKRRTRKKKAKDGRADIRRVPNHDGDPIDEGSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.13
6 0.13
7 0.13
8 0.14
9 0.14
10 0.14
11 0.13
12 0.12
13 0.11
14 0.1
15 0.1
16 0.11
17 0.18
18 0.19
19 0.21
20 0.21
21 0.23
22 0.25
23 0.29
24 0.31
25 0.27
26 0.28
27 0.26
28 0.28
29 0.26
30 0.23
31 0.2
32 0.15
33 0.11
34 0.09
35 0.08
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.09
43 0.1
44 0.11
45 0.1
46 0.11
47 0.12
48 0.15
49 0.21
50 0.26
51 0.33
52 0.41
53 0.48
54 0.58
55 0.69
56 0.77
57 0.82
58 0.86
59 0.89
60 0.91
61 0.95
62 0.95
63 0.95
64 0.94
65 0.93
66 0.92
67 0.9
68 0.85
69 0.8
70 0.8
71 0.74
72 0.68
73 0.64
74 0.59
75 0.53
76 0.52
77 0.46
78 0.39
79 0.37
80 0.33