Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QQ08

Protein Details
Accession E3QQ08    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
397-419TEVLVWQKKRAHGRRSIRFRHHIHydrophilic
NLS Segment(s)
PositionSequence
405-414KRAHGRRSIR
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKGTFVSALALLASQAAAHMAITYPPPLRSKENPYSGYDIDYSITSPLSASGSDFPCKGDLKLLGTPEATPVATWQAGQTYNMTIAGGANHNGGSCQAALSFDSGKTFTVIHSYIGACPAAGTSSLKFTLPADTPSAKDAIFAWTWFNNIGNREFYMNCAVITITGGGAGGSTATSFNSRPQIFKANIANGCSTVEGSDVMFPDPGPDVTMAGTKTAAPVGNCGAVVAPNPGTGGGGSGSAPSSSKSVEAAPSATQAPQSSTLAPTTTRPAGGASSLPGGVFMTVPAPSNASAASSVQPTTFATVSQPAAPSDDCTSELGVTVSVPAASSATPTLAPSPSAGSGGDAADGSMTPGKACNPEGQWNCVSGTHFQRCASGQWSVLMSMAPGTKCQSGTTEVLVWQKKRAHGRRSIRFRHHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.08
10 0.12
11 0.14
12 0.18
13 0.21
14 0.25
15 0.31
16 0.37
17 0.46
18 0.52
19 0.58
20 0.58
21 0.59
22 0.62
23 0.55
24 0.51
25 0.43
26 0.34
27 0.26
28 0.23
29 0.19
30 0.13
31 0.13
32 0.09
33 0.08
34 0.09
35 0.09
36 0.09
37 0.1
38 0.15
39 0.18
40 0.21
41 0.21
42 0.21
43 0.23
44 0.25
45 0.23
46 0.22
47 0.22
48 0.25
49 0.28
50 0.29
51 0.27
52 0.26
53 0.26
54 0.23
55 0.21
56 0.16
57 0.12
58 0.12
59 0.13
60 0.13
61 0.13
62 0.12
63 0.13
64 0.14
65 0.15
66 0.16
67 0.13
68 0.14
69 0.14
70 0.13
71 0.1
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.09
88 0.11
89 0.1
90 0.11
91 0.11
92 0.11
93 0.12
94 0.11
95 0.1
96 0.13
97 0.13
98 0.12
99 0.14
100 0.14
101 0.14
102 0.15
103 0.15
104 0.1
105 0.09
106 0.09
107 0.07
108 0.07
109 0.08
110 0.07
111 0.1
112 0.11
113 0.11
114 0.11
115 0.12
116 0.15
117 0.15
118 0.16
119 0.18
120 0.19
121 0.19
122 0.2
123 0.21
124 0.16
125 0.15
126 0.14
127 0.13
128 0.12
129 0.12
130 0.13
131 0.12
132 0.13
133 0.13
134 0.14
135 0.13
136 0.15
137 0.16
138 0.16
139 0.16
140 0.18
141 0.17
142 0.17
143 0.18
144 0.16
145 0.14
146 0.13
147 0.12
148 0.09
149 0.1
150 0.08
151 0.04
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.02
159 0.03
160 0.03
161 0.03
162 0.05
163 0.06
164 0.09
165 0.16
166 0.17
167 0.18
168 0.2
169 0.26
170 0.26
171 0.31
172 0.32
173 0.31
174 0.31
175 0.32
176 0.3
177 0.23
178 0.23
179 0.18
180 0.14
181 0.08
182 0.07
183 0.05
184 0.05
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.07
192 0.07
193 0.06
194 0.06
195 0.06
196 0.06
197 0.08
198 0.07
199 0.07
200 0.07
201 0.06
202 0.07
203 0.08
204 0.08
205 0.06
206 0.08
207 0.08
208 0.09
209 0.08
210 0.08
211 0.07
212 0.06
213 0.07
214 0.07
215 0.06
216 0.05
217 0.06
218 0.06
219 0.06
220 0.05
221 0.05
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.05
228 0.05
229 0.06
230 0.06
231 0.06
232 0.07
233 0.07
234 0.08
235 0.09
236 0.1
237 0.1
238 0.1
239 0.11
240 0.12
241 0.11
242 0.11
243 0.1
244 0.11
245 0.12
246 0.13
247 0.12
248 0.13
249 0.13
250 0.13
251 0.13
252 0.13
253 0.15
254 0.15
255 0.14
256 0.13
257 0.13
258 0.13
259 0.13
260 0.12
261 0.09
262 0.09
263 0.09
264 0.09
265 0.08
266 0.07
267 0.07
268 0.06
269 0.05
270 0.05
271 0.05
272 0.06
273 0.06
274 0.08
275 0.08
276 0.08
277 0.08
278 0.08
279 0.08
280 0.09
281 0.1
282 0.1
283 0.1
284 0.1
285 0.11
286 0.1
287 0.12
288 0.11
289 0.1
290 0.1
291 0.13
292 0.14
293 0.15
294 0.16
295 0.13
296 0.16
297 0.16
298 0.16
299 0.15
300 0.16
301 0.15
302 0.15
303 0.15
304 0.13
305 0.13
306 0.11
307 0.09
308 0.08
309 0.07
310 0.06
311 0.05
312 0.05
313 0.05
314 0.05
315 0.05
316 0.06
317 0.06
318 0.07
319 0.08
320 0.08
321 0.11
322 0.11
323 0.11
324 0.11
325 0.13
326 0.13
327 0.13
328 0.13
329 0.11
330 0.11
331 0.11
332 0.11
333 0.08
334 0.07
335 0.07
336 0.07
337 0.07
338 0.09
339 0.08
340 0.08
341 0.1
342 0.12
343 0.15
344 0.17
345 0.21
346 0.23
347 0.33
348 0.36
349 0.4
350 0.4
351 0.38
352 0.37
353 0.34
354 0.31
355 0.28
356 0.34
357 0.35
358 0.37
359 0.36
360 0.38
361 0.37
362 0.39
363 0.36
364 0.3
365 0.24
366 0.24
367 0.24
368 0.21
369 0.2
370 0.16
371 0.13
372 0.13
373 0.16
374 0.14
375 0.14
376 0.17
377 0.2
378 0.2
379 0.22
380 0.22
381 0.23
382 0.25
383 0.27
384 0.26
385 0.27
386 0.34
387 0.4
388 0.38
389 0.41
390 0.44
391 0.48
392 0.56
393 0.62
394 0.63
395 0.67
396 0.77
397 0.81
398 0.86
399 0.89