Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q8L7

Protein Details
Accession E3Q8L7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-105HYRHPRLMLARSRRRSRTQRRWIBasic
NLS Segment(s)
PositionSequence
92-103ARSRRRSRTQRR
Subcellular Location(s) nucl 14, mito 7, cyto 4.5, cyto_pero 3.5
Family & Domain DBs
Amino Acid Sequences MPSGRLICGNHDHGAVIGIRKQLDTLSEEDVTQFEPDFDKATVQIHSLPVLVKWQILLQQAAAHLNLIRSTRIFKDFKPPIHHYRHPRLMLARSRRRSRTQRRWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.15
4 0.15
5 0.16
6 0.16
7 0.15
8 0.16
9 0.14
10 0.15
11 0.16
12 0.15
13 0.16
14 0.16
15 0.16
16 0.16
17 0.16
18 0.15
19 0.13
20 0.1
21 0.07
22 0.08
23 0.08
24 0.1
25 0.1
26 0.09
27 0.09
28 0.11
29 0.11
30 0.1
31 0.11
32 0.09
33 0.1
34 0.1
35 0.09
36 0.08
37 0.09
38 0.08
39 0.07
40 0.07
41 0.07
42 0.09
43 0.1
44 0.1
45 0.09
46 0.1
47 0.1
48 0.11
49 0.1
50 0.08
51 0.07
52 0.07
53 0.09
54 0.09
55 0.09
56 0.09
57 0.12
58 0.14
59 0.21
60 0.22
61 0.22
62 0.32
63 0.37
64 0.43
65 0.49
66 0.53
67 0.55
68 0.63
69 0.69
70 0.68
71 0.72
72 0.75
73 0.69
74 0.67
75 0.64
76 0.64
77 0.65
78 0.67
79 0.67
80 0.68
81 0.74
82 0.77
83 0.81
84 0.84
85 0.86