Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H9U0

Protein Details
Accession Q2H9U0    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-34LSSSRLARDTKHKHKHKHKRKHALRATDPAEBasic
NLS Segment(s)
PositionSequence
13-26TKHKHKHKHKRKHA
Subcellular Location(s) mito 14.5, mito_nucl 13.833, nucl 12, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MACLSSSRLARDTKHKHKHKHKRKHALRATDPAEWTAVRQVGDHWAMSDGEAGQLSQSNMAEPARSVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.75
4 0.84
5 0.91
6 0.91
7 0.92
8 0.92
9 0.93
10 0.93
11 0.94
12 0.91
13 0.89
14 0.83
15 0.8
16 0.73
17 0.64
18 0.55
19 0.44
20 0.36
21 0.26
22 0.21
23 0.15
24 0.13
25 0.1
26 0.1
27 0.1
28 0.13
29 0.14
30 0.13
31 0.12
32 0.12
33 0.11
34 0.11
35 0.12
36 0.08
37 0.07
38 0.08
39 0.07
40 0.06
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.11
47 0.12
48 0.12