Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q6X1

Protein Details
Accession E3Q6X1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
100-128GVEIKLSRKSEKKRQKSLLKKKTKIGGNCHydrophilic
NLS Segment(s)
PositionSequence
106-123SRKSEKKRQKSLLKKKTK
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences SGNNRLIIVHSLIVRAASYPRQAAGISDSEDCSKITKGICCQNRKEKSRFLPYRSLVVISFPLLSQLRSARRVDHQYAPRTSSAFSSKVVFRNGNTEVYGVEIKLSRKSEKKRQKSLLKKKTKIGGNCTLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.13
4 0.14
5 0.16
6 0.16
7 0.16
8 0.17
9 0.17
10 0.17
11 0.17
12 0.16
13 0.16
14 0.16
15 0.17
16 0.17
17 0.17
18 0.17
19 0.15
20 0.13
21 0.14
22 0.15
23 0.18
24 0.22
25 0.3
26 0.38
27 0.42
28 0.49
29 0.57
30 0.64
31 0.67
32 0.67
33 0.67
34 0.67
35 0.72
36 0.71
37 0.66
38 0.66
39 0.6
40 0.59
41 0.5
42 0.44
43 0.32
44 0.27
45 0.22
46 0.14
47 0.12
48 0.08
49 0.1
50 0.09
51 0.09
52 0.09
53 0.13
54 0.15
55 0.18
56 0.19
57 0.18
58 0.23
59 0.29
60 0.32
61 0.36
62 0.4
63 0.43
64 0.44
65 0.44
66 0.4
67 0.35
68 0.32
69 0.27
70 0.24
71 0.19
72 0.18
73 0.19
74 0.21
75 0.24
76 0.27
77 0.26
78 0.22
79 0.27
80 0.28
81 0.27
82 0.24
83 0.2
84 0.16
85 0.18
86 0.18
87 0.12
88 0.11
89 0.12
90 0.13
91 0.19
92 0.22
93 0.26
94 0.34
95 0.43
96 0.53
97 0.61
98 0.71
99 0.76
100 0.83
101 0.87
102 0.9
103 0.93
104 0.93
105 0.93
106 0.89
107 0.86
108 0.85
109 0.82
110 0.79
111 0.76