Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QGT9

Protein Details
Accession E3QGT9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
140-165GKEIRFGHKKRPKRLRGEKVDTKGVEBasic
NLS Segment(s)
PositionSequence
144-157RFGHKKRPKRLRGE
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003837  Asp/Glu-ADT_csu  
IPR036113  Asp/Glu-ADT_sf_sub_c  
Gene Ontology GO:0006450  P:regulation of translational fidelity  
Pfam View protein in Pfam  
PF02686  Glu-tRNAGln  
Amino Acid Sequences MRPVCRRCSALLRQARRFTSSSARPSISNSASALLSKPVWSVASLLPPGSKADAPPNSTEEPISRVKLHHLLRLSALPLPESEAEESAMLRTLHSQLHFVRDVQSVDTTGVEPLRSLRDETTEGVAEAAIGLQELQDALGKEIRFGHKKRPKRLRGEKVDTKGVEDWDPLKTASRTAGKYFIVQSRKEVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.67
4 0.6
5 0.54
6 0.54
7 0.53
8 0.51
9 0.5
10 0.48
11 0.44
12 0.47
13 0.5
14 0.41
15 0.35
16 0.29
17 0.25
18 0.24
19 0.24
20 0.2
21 0.15
22 0.14
23 0.12
24 0.12
25 0.11
26 0.11
27 0.11
28 0.12
29 0.11
30 0.16
31 0.16
32 0.16
33 0.15
34 0.15
35 0.16
36 0.15
37 0.14
38 0.11
39 0.19
40 0.23
41 0.25
42 0.26
43 0.29
44 0.29
45 0.29
46 0.28
47 0.21
48 0.21
49 0.21
50 0.22
51 0.19
52 0.18
53 0.21
54 0.28
55 0.29
56 0.29
57 0.27
58 0.26
59 0.26
60 0.27
61 0.24
62 0.18
63 0.16
64 0.12
65 0.1
66 0.12
67 0.1
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.09
74 0.07
75 0.09
76 0.07
77 0.07
78 0.07
79 0.09
80 0.1
81 0.1
82 0.13
83 0.11
84 0.15
85 0.16
86 0.15
87 0.16
88 0.17
89 0.17
90 0.15
91 0.15
92 0.11
93 0.11
94 0.11
95 0.09
96 0.08
97 0.08
98 0.06
99 0.06
100 0.07
101 0.09
102 0.09
103 0.1
104 0.1
105 0.13
106 0.15
107 0.16
108 0.17
109 0.15
110 0.14
111 0.13
112 0.12
113 0.09
114 0.07
115 0.06
116 0.03
117 0.03
118 0.02
119 0.02
120 0.02
121 0.02
122 0.03
123 0.05
124 0.05
125 0.07
126 0.11
127 0.11
128 0.12
129 0.17
130 0.23
131 0.28
132 0.3
133 0.4
134 0.46
135 0.56
136 0.66
137 0.72
138 0.76
139 0.8
140 0.89
141 0.88
142 0.9
143 0.91
144 0.89
145 0.84
146 0.83
147 0.72
148 0.65
149 0.57
150 0.48
151 0.4
152 0.32
153 0.28
154 0.22
155 0.23
156 0.19
157 0.22
158 0.2
159 0.2
160 0.25
161 0.3
162 0.32
163 0.34
164 0.39
165 0.35
166 0.38
167 0.42
168 0.43
169 0.42
170 0.4