FuNGI

E3QFR7

Protein Details

Accession

E3QFR7

Localization Confidence

Medium

Confidence Score

13.7

NoLS Segment(s)

Position	Sequence	Protein Nature
414-449	DQSGSRSPRHRSRDDYRDRRKRSPSLDRDHRDSDKR	Basic

NLS Segment(s)

Position	Sequence
396-450	GPKRGWPDRYRSRDDFRRDQSGSRSPRHRSRDDYRDRRKRSPSLDRDHRDSDKRR

Subcellular Location(s)

nucl 22.5, cyto_nucl 13.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR033194 MFAP1 IPR009730 MFAP1_C
Pfam	View protein in Pfam PF06991 MFAP1

Amino Acid Sequences

MPPKRMTANPVKPARYRAGKPIAPETSDSDSDISDNDTNEAENKARAIPPPPKASSAAKIARSLSKVNLDERRREAQEKENLRIAREKAERIAAEEGFVTEEEEEEEEGDDGEEESSSEEESSSEEEAPRRLMIRPKFIPKNQRNAAKDQSAASKDEDARFAEEEARRKAAADALVEEQIKKDLAARAAGKKHWDDDEASGSDVDTTDDLDPEAELAAWKLRELKRVKRERDRIAEQEAEYAERERRQNLTQEERDAEDAEKLARQQEEKDAKGKMSYLQKYYHKGAFYSDEAKAYGLDKRDIMGMRIADDVKDRSALPEYLQKRDMTKLGRKGATKYKDLKSEDTGRWGEFDDRRGGDRRGFNKYDVDERFRPDNDREVNGANAIPLGDRKAPDGPKRGWPDRYRSRDDFRRDQSGSRSPRHRSRDDYRDRRKRSPSLDRDHRDSDKRRRVDS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.71
2	0.69
3	0.63
4	0.63
5	0.64
6	0.61
7	0.61
8	0.64
9	0.6
10	0.53
11	0.51
12	0.46
13	0.42
14	0.41
15	0.38
16	0.29
17	0.25
18	0.23
19	0.21
20	0.2
21	0.16
22	0.15
23	0.15
24	0.15
25	0.15
26	0.16
27	0.19
28	0.16
29	0.15
30	0.16
31	0.18
32	0.2
33	0.22
34	0.29
35	0.34
36	0.4
37	0.47
38	0.48
39	0.48
40	0.5
41	0.52
42	0.49
43	0.5
44	0.49
45	0.44
46	0.45
47	0.45
48	0.46
49	0.44
50	0.42
51	0.37
52	0.38
53	0.38
54	0.42
55	0.48
56	0.48
57	0.52
58	0.55
59	0.58
60	0.54
61	0.56
62	0.53
63	0.53
64	0.58
65	0.57
66	0.56
67	0.56
68	0.52
69	0.5
70	0.52
71	0.44
72	0.44
73	0.42
74	0.41
75	0.36
76	0.41
77	0.39
78	0.36
79	0.38
80	0.29
81	0.25
82	0.22
83	0.19
84	0.14
85	0.14
86	0.11
87	0.07
88	0.07
89	0.07
90	0.08
91	0.07
92	0.07
93	0.07
94	0.06
95	0.07
96	0.06
97	0.06
98	0.05
99	0.06
100	0.05
101	0.05
102	0.05
103	0.06
104	0.06
105	0.06
106	0.05
107	0.05
108	0.07
109	0.08
110	0.09
111	0.1
112	0.12
113	0.13
114	0.14
115	0.15
116	0.15
117	0.15
118	0.17
119	0.24
120	0.28
121	0.35
122	0.4
123	0.48
124	0.55
125	0.6
126	0.68
127	0.66
128	0.72
129	0.7
130	0.73
131	0.67
132	0.66
133	0.65
134	0.57
135	0.52
136	0.43
137	0.43
138	0.36
139	0.34
140	0.29
141	0.28
142	0.27
143	0.27
144	0.27
145	0.21
146	0.21
147	0.2
148	0.2
149	0.21
150	0.22
151	0.26
152	0.26
153	0.27
154	0.25
155	0.25
156	0.25
157	0.22
158	0.21
159	0.16
160	0.15
161	0.15
162	0.17
163	0.17
164	0.16
165	0.13
166	0.12
167	0.11
168	0.09
169	0.1
170	0.11
171	0.12
172	0.16
173	0.18
174	0.23
175	0.26
176	0.28
177	0.28
178	0.26
179	0.27
180	0.25
181	0.24
182	0.2
183	0.19
184	0.22
185	0.19
186	0.18
187	0.16
188	0.14
189	0.13
190	0.11
191	0.09
192	0.05
193	0.06
194	0.05
195	0.05
196	0.05
197	0.05
198	0.05
199	0.05
200	0.05
201	0.03
202	0.03
203	0.03
204	0.05
205	0.05
206	0.05
207	0.12
208	0.13
209	0.21
210	0.26
211	0.35
212	0.44
213	0.53
214	0.61
215	0.65
216	0.72
217	0.72
218	0.75
219	0.72
220	0.65
221	0.6
222	0.55
223	0.45
224	0.39
225	0.31
226	0.24
227	0.19
228	0.17
229	0.14
230	0.15
231	0.16
232	0.15
233	0.18
234	0.2
235	0.26
236	0.3
237	0.37
238	0.35
239	0.37
240	0.36
241	0.34
242	0.33
243	0.27
244	0.22
245	0.14
246	0.12
247	0.1
248	0.1
249	0.09
250	0.11
251	0.11
252	0.11
253	0.12
254	0.21
255	0.26
256	0.27
257	0.31
258	0.29
259	0.28
260	0.28
261	0.28
262	0.24
263	0.27
264	0.29
265	0.29
266	0.34
267	0.38
268	0.43
269	0.46
270	0.44
271	0.36
272	0.32
273	0.31
274	0.29
275	0.27
276	0.26
277	0.23
278	0.2
279	0.2
280	0.19
281	0.17
282	0.15
283	0.15
284	0.13
285	0.14
286	0.13
287	0.13
288	0.17
289	0.16
290	0.16
291	0.17
292	0.15
293	0.15
294	0.17
295	0.16
296	0.13
297	0.15
298	0.15
299	0.12
300	0.14
301	0.12
302	0.12
303	0.15
304	0.15
305	0.15
306	0.22
307	0.24
308	0.27
309	0.3
310	0.29
311	0.28
312	0.31
313	0.35
314	0.34
315	0.39
316	0.43
317	0.48
318	0.52
319	0.52
320	0.54
321	0.59
322	0.57
323	0.56
324	0.56
325	0.54
326	0.58
327	0.6
328	0.58
329	0.55
330	0.58
331	0.52
332	0.51
333	0.47
334	0.39
335	0.36
336	0.34
337	0.33
338	0.28
339	0.29
340	0.28
341	0.28
342	0.31
343	0.35
344	0.35
345	0.36
346	0.42
347	0.43
348	0.46
349	0.47
350	0.46
351	0.47
352	0.47
353	0.49
354	0.46
355	0.49
356	0.43
357	0.46
358	0.49
359	0.45
360	0.47
361	0.41
362	0.45
363	0.42
364	0.42
365	0.4
366	0.36
367	0.35
368	0.32
369	0.29
370	0.2
371	0.16
372	0.12
373	0.1
374	0.09
375	0.12
376	0.14
377	0.14
378	0.17
379	0.24
380	0.31
381	0.38
382	0.45
383	0.45
384	0.52
385	0.6
386	0.65
387	0.67
388	0.66
389	0.69
390	0.72
391	0.77
392	0.76
393	0.74
394	0.77
395	0.77
396	0.79
397	0.79
398	0.75
399	0.76
400	0.69
401	0.67
402	0.66
403	0.66
404	0.65
405	0.64
406	0.66
407	0.65
408	0.72
409	0.76
410	0.75
411	0.74
412	0.76
413	0.78
414	0.81
415	0.84
416	0.85
417	0.88
418	0.89
419	0.89
420	0.89
421	0.87
422	0.86
423	0.86
424	0.85
425	0.86
426	0.88
427	0.86
428	0.84
429	0.83
430	0.81
431	0.79
432	0.79
433	0.79
434	0.79

E3QFR7

3D AlphaFold-predicted Structure Viewer