Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QLW6

Protein Details
Accession E3QLW6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPRRRRRRSRRRVVVVVVVVHydrophilic
NLS Segment(s)
PositionSequence
3-12RRRRRRSRRR
Subcellular Location(s) plas 8, extr 7, mito 4, E.R. 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPRRRRRRSRRRVVVVVVVVLWCFGYWVLAVFVRLIPVDSSVALGSLYSAQATLRGRSRAQAGENGPMRGGGWLGSFDKSEREREWRGEEEKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.72
3 0.61
4 0.5
5 0.39
6 0.28
7 0.2
8 0.15
9 0.06
10 0.05
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.06
24 0.06
25 0.07
26 0.06
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.07
39 0.08
40 0.1
41 0.13
42 0.16
43 0.16
44 0.18
45 0.22
46 0.21
47 0.22
48 0.26
49 0.24
50 0.3
51 0.32
52 0.3
53 0.27
54 0.24
55 0.23
56 0.17
57 0.15
58 0.08
59 0.06
60 0.08
61 0.1
62 0.11
63 0.11
64 0.12
65 0.18
66 0.2
67 0.24
68 0.26
69 0.32
70 0.36
71 0.41
72 0.47
73 0.47
74 0.51