FuNGI

E3Q2D2

Protein Details

Accession

E3Q2D2

Localization Confidence

Medium

Confidence Score

11.4

NoLS Segment(s)

Position	Sequence	Protein Nature
359-382	KPVKPISEKERKEKPKERSFQAKM	Basic

NLS Segment(s)

Position	Sequence
362-375	KPISEKERKEKPKE

Subcellular Location(s)

nucl 13, cyto_nucl 11, mito 7, cyto 7

Family & Domain DBs

InterPro	View protein in InterPro IPR027539 Mdm10
Gene Ontology	GO:0032865 C:ERMES complex GO:0000002 P:mitochondrial genome maintenance GO:0070096 P:mitochondrial outer membrane translocase complex assembly GO:1990456 P:mitochondrion-endoplasmic reticulum membrane tethering GO:0045040 P:protein insertion into mitochondrial outer membrane
Pfam	View protein in Pfam PF12519 MDM10

Amino Acid Sequences

MREFMSYVQSAFYEATGWNRDNSYSSLNATADSLLKFPTPQGLRLTLSSLATPHFATSYQLGSVGVVDGSISYLYSSVPLRAHLTPQSNAIPLPALLRSYRPLADLPPRPDKRTYPLLSPAAASLLYGRLYLPESMLEALVVKRISPALQLQVSAVSGKFLRNGGTLLGLAQYDVGRYAIEGLGSSDGGLLGFRGVYNFGGDAENNQPSQSRSTGRLNGKPIGLSDETKERIYGRFSAGGEIYYGTLNKSGGISFGGRFATLPEHRGTPLTATLTINPLMGNISASYAVVAGQHCSLATRMDFNVYSYESDWSVGMELWRKNLTRNIEPALSAENFVQKERSFQAKLEWRLDEPEALPKPVKPISEKERKEKPKERSFQAKMEWRLDDPDLDGTESGDGGTPQATGVDEYGSVIKARLDQNMKIGVLWEGRFKSLLFSLGSAIDLRKLDSPFRTVGVEIQFSS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.16
3	0.2
4	0.21
5	0.22
6	0.23
7	0.24
8	0.25
9	0.28
10	0.27
11	0.24
12	0.25
13	0.26
14	0.25
15	0.24
16	0.22
17	0.21
18	0.19
19	0.18
20	0.16
21	0.14
22	0.14
23	0.14
24	0.14
25	0.21
26	0.21
27	0.24
28	0.28
29	0.31
30	0.32
31	0.33
32	0.35
33	0.29
34	0.27
35	0.24
36	0.21
37	0.18
38	0.17
39	0.16
40	0.14
41	0.12
42	0.12
43	0.13
44	0.14
45	0.14
46	0.13
47	0.13
48	0.12
49	0.12
50	0.12
51	0.1
52	0.08
53	0.06
54	0.05
55	0.04
56	0.05
57	0.05
58	0.04
59	0.04
60	0.05
61	0.05
62	0.07
63	0.08
64	0.1
65	0.11
66	0.13
67	0.17
68	0.18
69	0.22
70	0.26
71	0.3
72	0.28
73	0.32
74	0.32
75	0.29
76	0.28
77	0.25
78	0.19
79	0.15
80	0.16
81	0.12
82	0.12
83	0.11
84	0.14
85	0.16
86	0.18
87	0.18
88	0.18
89	0.18
90	0.22
91	0.3
92	0.36
93	0.39
94	0.47
95	0.5
96	0.52
97	0.55
98	0.54
99	0.51
100	0.54
101	0.51
102	0.45
103	0.49
104	0.48
105	0.44
106	0.41
107	0.35
108	0.25
109	0.22
110	0.17
111	0.09
112	0.09
113	0.08
114	0.08
115	0.07
116	0.08
117	0.09
118	0.1
119	0.09
120	0.08
121	0.09
122	0.09
123	0.09
124	0.08
125	0.07
126	0.07
127	0.09
128	0.09
129	0.08
130	0.08
131	0.09
132	0.09
133	0.1
134	0.12
135	0.14
136	0.15
137	0.15
138	0.14
139	0.15
140	0.14
141	0.13
142	0.11
143	0.08
144	0.08
145	0.08
146	0.09
147	0.09
148	0.11
149	0.1
150	0.11
151	0.1
152	0.1
153	0.1
154	0.08
155	0.08
156	0.07
157	0.06
158	0.06
159	0.06
160	0.05
161	0.05
162	0.05
163	0.04
164	0.04
165	0.06
166	0.05
167	0.05
168	0.05
169	0.05
170	0.06
171	0.06
172	0.06
173	0.04
174	0.04
175	0.04
176	0.04
177	0.03
178	0.03
179	0.03
180	0.03
181	0.03
182	0.04
183	0.04
184	0.05
185	0.05
186	0.06
187	0.06
188	0.06
189	0.08
190	0.1
191	0.12
192	0.11
193	0.11
194	0.12
195	0.12
196	0.15
197	0.15
198	0.15
199	0.17
200	0.22
201	0.3
202	0.34
203	0.38
204	0.39
205	0.39
206	0.37
207	0.33
208	0.28
209	0.25
210	0.21
211	0.17
212	0.15
213	0.17
214	0.18
215	0.18
216	0.18
217	0.15
218	0.15
219	0.16
220	0.17
221	0.14
222	0.16
223	0.16
224	0.17
225	0.16
226	0.15
227	0.13
228	0.11
229	0.1
230	0.07
231	0.07
232	0.05
233	0.06
234	0.06
235	0.06
236	0.06
237	0.05
238	0.06
239	0.07
240	0.07
241	0.07
242	0.09
243	0.09
244	0.08
245	0.08
246	0.09
247	0.13
248	0.13
249	0.15
250	0.14
251	0.15
252	0.16
253	0.16
254	0.16
255	0.12
256	0.13
257	0.12
258	0.13
259	0.12
260	0.13
261	0.14
262	0.14
263	0.13
264	0.1
265	0.09
266	0.08
267	0.07
268	0.07
269	0.05
270	0.05
271	0.05
272	0.05
273	0.05
274	0.05
275	0.05
276	0.06
277	0.06
278	0.06
279	0.06
280	0.06
281	0.06
282	0.07
283	0.07
284	0.07
285	0.08
286	0.09
287	0.09
288	0.11
289	0.12
290	0.12
291	0.14
292	0.13
293	0.14
294	0.13
295	0.14
296	0.11
297	0.12
298	0.11
299	0.09
300	0.09
301	0.08
302	0.09
303	0.13
304	0.13
305	0.16
306	0.19
307	0.2
308	0.22
309	0.27
310	0.31
311	0.31
312	0.34
313	0.35
314	0.33
315	0.32
316	0.3
317	0.29
318	0.23
319	0.19
320	0.16
321	0.17
322	0.17
323	0.17
324	0.2
325	0.16
326	0.19
327	0.22
328	0.28
329	0.25
330	0.25
331	0.33
332	0.39
333	0.44
334	0.45
335	0.44
336	0.38
337	0.4
338	0.4
339	0.34
340	0.26
341	0.29
342	0.26
343	0.27
344	0.26
345	0.24
346	0.28
347	0.29
348	0.31
349	0.26
350	0.33
351	0.4
352	0.5
353	0.55
354	0.58
355	0.66
356	0.72
357	0.79
358	0.8
359	0.81
360	0.81
361	0.84
362	0.83
363	0.83
364	0.79
365	0.76
366	0.75
367	0.74
368	0.69
369	0.66
370	0.6
371	0.51
372	0.49
373	0.43
374	0.35
375	0.28
376	0.25
377	0.21
378	0.2
379	0.18
380	0.15
381	0.14
382	0.12
383	0.11
384	0.08
385	0.07
386	0.06
387	0.07
388	0.06
389	0.06
390	0.06
391	0.07
392	0.07
393	0.07
394	0.07
395	0.07
396	0.08
397	0.1
398	0.1
399	0.1
400	0.09
401	0.1
402	0.15
403	0.17
404	0.24
405	0.28
406	0.29
407	0.34
408	0.38
409	0.37
410	0.32
411	0.31
412	0.26
413	0.26
414	0.25
415	0.27
416	0.23
417	0.24
418	0.25
419	0.24
420	0.25
421	0.22
422	0.24
423	0.19
424	0.18
425	0.19
426	0.18
427	0.19
428	0.16
429	0.15
430	0.16
431	0.15
432	0.16
433	0.2
434	0.22
435	0.26
436	0.28
437	0.32
438	0.3
439	0.32
440	0.32
441	0.27
442	0.31
443	0.3

E3Q2D2

3D AlphaFold-predicted Structure Viewer