Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q2D2

Protein Details
Accession E3Q2D2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
359-382KPVKPISEKERKEKPKERSFQAKMBasic
NLS Segment(s)
PositionSequence
362-375KPISEKERKEKPKE
Subcellular Location(s) nucl 13, cyto_nucl 11, mito 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027539  Mdm10  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0000002  P:mitochondrial genome maintenance  
GO:0070096  P:mitochondrial outer membrane translocase complex assembly  
GO:1990456  P:mitochondrion-endoplasmic reticulum membrane tethering  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
Pfam View protein in Pfam  
PF12519  MDM10  
Amino Acid Sequences MREFMSYVQSAFYEATGWNRDNSYSSLNATADSLLKFPTPQGLRLTLSSLATPHFATSYQLGSVGVVDGSISYLYSSVPLRAHLTPQSNAIPLPALLRSYRPLADLPPRPDKRTYPLLSPAAASLLYGRLYLPESMLEALVVKRISPALQLQVSAVSGKFLRNGGTLLGLAQYDVGRYAIEGLGSSDGGLLGFRGVYNFGGDAENNQPSQSRSTGRLNGKPIGLSDETKERIYGRFSAGGEIYYGTLNKSGGISFGGRFATLPEHRGTPLTATLTINPLMGNISASYAVVAGQHCSLATRMDFNVYSYESDWSVGMELWRKNLTRNIEPALSAENFVQKERSFQAKLEWRLDEPEALPKPVKPISEKERKEKPKERSFQAKMEWRLDDPDLDGTESGDGGTPQATGVDEYGSVIKARLDQNMKIGVLWEGRFKSLLFSLGSAIDLRKLDSPFRTVGVEIQFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.2
4 0.21
5 0.22
6 0.23
7 0.24
8 0.25
9 0.28
10 0.27
11 0.24
12 0.25
13 0.26
14 0.25
15 0.24
16 0.22
17 0.21
18 0.19
19 0.18
20 0.16
21 0.14
22 0.14
23 0.14
24 0.14
25 0.21
26 0.21
27 0.24
28 0.28
29 0.31
30 0.32
31 0.33
32 0.35
33 0.29
34 0.27
35 0.24
36 0.21
37 0.18
38 0.17
39 0.16
40 0.14
41 0.12
42 0.12
43 0.13
44 0.14
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.12
51 0.1
52 0.08
53 0.06
54 0.05
55 0.04
56 0.05
57 0.05
58 0.04
59 0.04
60 0.05
61 0.05
62 0.07
63 0.08
64 0.1
65 0.11
66 0.13
67 0.17
68 0.18
69 0.22
70 0.26
71 0.3
72 0.28
73 0.32
74 0.32
75 0.29
76 0.28
77 0.25
78 0.19
79 0.15
80 0.16
81 0.12
82 0.12
83 0.11
84 0.14
85 0.16
86 0.18
87 0.18
88 0.18
89 0.18
90 0.22
91 0.3
92 0.36
93 0.39
94 0.47
95 0.5
96 0.52
97 0.55
98 0.54
99 0.51
100 0.54
101 0.51
102 0.45
103 0.49
104 0.48
105 0.44
106 0.41
107 0.35
108 0.25
109 0.22
110 0.17
111 0.09
112 0.09
113 0.08
114 0.08
115 0.07
116 0.08
117 0.09
118 0.1
119 0.09
120 0.08
121 0.09
122 0.09
123 0.09
124 0.08
125 0.07
126 0.07
127 0.09
128 0.09
129 0.08
130 0.08
131 0.09
132 0.09
133 0.1
134 0.12
135 0.14
136 0.15
137 0.15
138 0.14
139 0.15
140 0.14
141 0.13
142 0.11
143 0.08
144 0.08
145 0.08
146 0.09
147 0.09
148 0.11
149 0.1
150 0.11
151 0.1
152 0.1
153 0.1
154 0.08
155 0.08
156 0.07
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.05
163 0.04
164 0.04
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.08
190 0.1
191 0.12
192 0.11
193 0.11
194 0.12
195 0.12
196 0.15
197 0.15
198 0.15
199 0.17
200 0.22
201 0.3
202 0.34
203 0.38
204 0.39
205 0.39
206 0.37
207 0.33
208 0.28
209 0.25
210 0.21
211 0.17
212 0.15
213 0.17
214 0.18
215 0.18
216 0.18
217 0.15
218 0.15
219 0.16
220 0.17
221 0.14
222 0.16
223 0.16
224 0.17
225 0.16
226 0.15
227 0.13
228 0.11
229 0.1
230 0.07
231 0.07
232 0.05
233 0.06
234 0.06
235 0.06
236 0.06
237 0.05
238 0.06
239 0.07
240 0.07
241 0.07
242 0.09
243 0.09
244 0.08
245 0.08
246 0.09
247 0.13
248 0.13
249 0.15
250 0.14
251 0.15
252 0.16
253 0.16
254 0.16
255 0.12
256 0.13
257 0.12
258 0.13
259 0.12
260 0.13
261 0.14
262 0.14
263 0.13
264 0.1
265 0.09
266 0.08
267 0.07
268 0.07
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.05
275 0.05
276 0.06
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.07
283 0.07
284 0.07
285 0.08
286 0.09
287 0.09
288 0.11
289 0.12
290 0.12
291 0.14
292 0.13
293 0.14
294 0.13
295 0.14
296 0.11
297 0.12
298 0.11
299 0.09
300 0.09
301 0.08
302 0.09
303 0.13
304 0.13
305 0.16
306 0.19
307 0.2
308 0.22
309 0.27
310 0.31
311 0.31
312 0.34
313 0.35
314 0.33
315 0.32
316 0.3
317 0.29
318 0.23
319 0.19
320 0.16
321 0.17
322 0.17
323 0.17
324 0.2
325 0.16
326 0.19
327 0.22
328 0.28
329 0.25
330 0.25
331 0.33
332 0.39
333 0.44
334 0.45
335 0.44
336 0.38
337 0.4
338 0.4
339 0.34
340 0.26
341 0.29
342 0.26
343 0.27
344 0.26
345 0.24
346 0.28
347 0.29
348 0.31
349 0.26
350 0.33
351 0.4
352 0.5
353 0.55
354 0.58
355 0.66
356 0.72
357 0.79
358 0.8
359 0.81
360 0.81
361 0.84
362 0.83
363 0.83
364 0.79
365 0.76
366 0.75
367 0.74
368 0.69
369 0.66
370 0.6
371 0.51
372 0.49
373 0.43
374 0.35
375 0.28
376 0.25
377 0.21
378 0.2
379 0.18
380 0.15
381 0.14
382 0.12
383 0.11
384 0.08
385 0.07
386 0.06
387 0.07
388 0.06
389 0.06
390 0.06
391 0.07
392 0.07
393 0.07
394 0.07
395 0.07
396 0.08
397 0.1
398 0.1
399 0.1
400 0.09
401 0.1
402 0.15
403 0.17
404 0.24
405 0.28
406 0.29
407 0.34
408 0.38
409 0.37
410 0.32
411 0.31
412 0.26
413 0.26
414 0.25
415 0.27
416 0.23
417 0.24
418 0.25
419 0.24
420 0.25
421 0.22
422 0.24
423 0.19
424 0.18
425 0.19
426 0.18
427 0.19
428 0.16
429 0.15
430 0.16
431 0.15
432 0.16
433 0.2
434 0.22
435 0.26
436 0.28
437 0.32
438 0.3
439 0.32
440 0.32
441 0.27
442 0.31
443 0.3