Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3QNB5

Protein Details
Accession E3QNB5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-90EDAVTNTRGRKRRRVTKVEDGQDAHydrophilic
114-136AARASPSKTRKVRKPARVIKGTDHydrophilic
NLS Segment(s)
PositionSequence
119-130PSKTRKVRKPAR
456-469RAAVPRRLRRGKPS
Subcellular Location(s) mito 18, cyto 6, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR004036  Endonuclease-III-like_CS2  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
IPR000445  HhH_motif  
IPR030841  NTH1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0140078  F:class I DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0003677  F:DNA binding  
GO:0000703  F:oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00633  HHH  
PF00730  HhH-GPD  
PROSITE View protein in PROSITE  
PS01155  ENDONUCLEASE_III_2  
CDD cd00056  ENDO3c  
Amino Acid Sequences MARPSSPLPTTTTTTTTAPSPPQQTRRTTRSSLARFAYNAGVSSTTDANAAAAETVHDIVLGVTDIEDAVTNTRGRKRRRVTKVEDGQDAHAEDGIVNIKIEHVETETTAAPAAARASPSKTRKVRKPARVIKGTDAVESHTEPPSDWESIYDAVKRMRLHGAARNAAVDTMGCERLFHPDASERDRRYHLLTALMLSSQTKDTVNAVAMKRLMTELPPHEPGAAGGLNLENVLAVDPAFLNELIWAVGFHNNKTKYIKAAAEILRDRFDGDIPDTIEGLTSLPGVGPKMAYLCLSAAWDRTEGIGVDVHVHRITNLWGWHKTTQPEATRLALQSWLPKDKWREINWLLVGFGQTLCLPVGRKCGECDLGLSGMCKAAERKKVNEGRRTREVKVEVKEQGDGSAVIKKEEVVKEEDVEQDRVVNEAAGVSELGPESGVEDSGQRPPEDATTGKANRAAVPRRLRRGKPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.3
4 0.29
5 0.3
6 0.33
7 0.38
8 0.44
9 0.52
10 0.57
11 0.64
12 0.69
13 0.71
14 0.72
15 0.68
16 0.68
17 0.69
18 0.69
19 0.67
20 0.62
21 0.58
22 0.52
23 0.5
24 0.46
25 0.36
26 0.3
27 0.24
28 0.21
29 0.18
30 0.19
31 0.17
32 0.13
33 0.12
34 0.11
35 0.1
36 0.09
37 0.09
38 0.06
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.07
57 0.1
58 0.11
59 0.17
60 0.25
61 0.33
62 0.4
63 0.5
64 0.59
65 0.67
66 0.76
67 0.81
68 0.82
69 0.85
70 0.88
71 0.83
72 0.79
73 0.7
74 0.62
75 0.54
76 0.46
77 0.35
78 0.26
79 0.19
80 0.13
81 0.12
82 0.12
83 0.09
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.08
90 0.08
91 0.08
92 0.09
93 0.11
94 0.11
95 0.11
96 0.11
97 0.1
98 0.08
99 0.08
100 0.09
101 0.08
102 0.09
103 0.1
104 0.15
105 0.24
106 0.29
107 0.38
108 0.45
109 0.53
110 0.61
111 0.71
112 0.76
113 0.78
114 0.85
115 0.85
116 0.86
117 0.85
118 0.79
119 0.73
120 0.7
121 0.61
122 0.51
123 0.41
124 0.33
125 0.27
126 0.26
127 0.22
128 0.17
129 0.16
130 0.15
131 0.18
132 0.19
133 0.18
134 0.16
135 0.14
136 0.15
137 0.16
138 0.18
139 0.16
140 0.15
141 0.15
142 0.19
143 0.19
144 0.19
145 0.21
146 0.22
147 0.24
148 0.29
149 0.33
150 0.32
151 0.32
152 0.3
153 0.27
154 0.24
155 0.2
156 0.14
157 0.09
158 0.09
159 0.1
160 0.09
161 0.1
162 0.1
163 0.16
164 0.18
165 0.16
166 0.16
167 0.2
168 0.23
169 0.29
170 0.35
171 0.31
172 0.33
173 0.35
174 0.35
175 0.33
176 0.34
177 0.29
178 0.25
179 0.23
180 0.21
181 0.18
182 0.17
183 0.13
184 0.1
185 0.1
186 0.07
187 0.08
188 0.07
189 0.07
190 0.08
191 0.09
192 0.1
193 0.15
194 0.15
195 0.16
196 0.16
197 0.15
198 0.15
199 0.14
200 0.13
201 0.08
202 0.12
203 0.13
204 0.16
205 0.17
206 0.17
207 0.17
208 0.16
209 0.15
210 0.14
211 0.11
212 0.07
213 0.06
214 0.06
215 0.06
216 0.06
217 0.05
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.09
236 0.1
237 0.11
238 0.17
239 0.18
240 0.21
241 0.23
242 0.23
243 0.21
244 0.25
245 0.25
246 0.19
247 0.26
248 0.26
249 0.29
250 0.3
251 0.28
252 0.26
253 0.25
254 0.24
255 0.17
256 0.15
257 0.11
258 0.11
259 0.12
260 0.11
261 0.12
262 0.11
263 0.1
264 0.1
265 0.08
266 0.07
267 0.05
268 0.04
269 0.04
270 0.04
271 0.04
272 0.05
273 0.05
274 0.05
275 0.05
276 0.06
277 0.06
278 0.06
279 0.06
280 0.06
281 0.07
282 0.08
283 0.08
284 0.09
285 0.09
286 0.09
287 0.09
288 0.09
289 0.09
290 0.08
291 0.08
292 0.08
293 0.07
294 0.1
295 0.1
296 0.12
297 0.11
298 0.11
299 0.1
300 0.1
301 0.11
302 0.12
303 0.15
304 0.18
305 0.2
306 0.24
307 0.27
308 0.3
309 0.3
310 0.31
311 0.35
312 0.34
313 0.35
314 0.34
315 0.33
316 0.32
317 0.31
318 0.27
319 0.22
320 0.2
321 0.22
322 0.24
323 0.27
324 0.26
325 0.3
326 0.35
327 0.42
328 0.49
329 0.47
330 0.51
331 0.48
332 0.55
333 0.52
334 0.47
335 0.38
336 0.31
337 0.27
338 0.19
339 0.17
340 0.1
341 0.08
342 0.08
343 0.08
344 0.09
345 0.1
346 0.1
347 0.18
348 0.2
349 0.21
350 0.23
351 0.27
352 0.28
353 0.27
354 0.27
355 0.21
356 0.2
357 0.19
358 0.18
359 0.14
360 0.13
361 0.13
362 0.12
363 0.14
364 0.2
365 0.3
366 0.34
367 0.37
368 0.46
369 0.55
370 0.63
371 0.68
372 0.7
373 0.68
374 0.74
375 0.76
376 0.68
377 0.67
378 0.66
379 0.63
380 0.6
381 0.59
382 0.54
383 0.5
384 0.49
385 0.41
386 0.35
387 0.29
388 0.24
389 0.18
390 0.18
391 0.17
392 0.15
393 0.15
394 0.15
395 0.21
396 0.23
397 0.25
398 0.24
399 0.26
400 0.27
401 0.3
402 0.35
403 0.31
404 0.3
405 0.27
406 0.25
407 0.23
408 0.22
409 0.2
410 0.14
411 0.1
412 0.09
413 0.09
414 0.07
415 0.07
416 0.06
417 0.07
418 0.07
419 0.07
420 0.07
421 0.06
422 0.07
423 0.07
424 0.08
425 0.07
426 0.09
427 0.11
428 0.17
429 0.2
430 0.19
431 0.2
432 0.21
433 0.23
434 0.25
435 0.24
436 0.22
437 0.3
438 0.32
439 0.33
440 0.35
441 0.34
442 0.36
443 0.44
444 0.48
445 0.47
446 0.56
447 0.63
448 0.7
449 0.78