Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3QGE6

Protein Details
Accession E3QGE6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
382-408SRYSHMPEVRRIKRHRHLPKVIKKAGEBasic
413-448ELQSIKRREENERRHTKKQFERRKGEREKPILAREKBasic
NLS Segment(s)
PositionSequence
391-448RRIKRHRHLPKVIKKAGEIKNVELQSIKRREENERRHTKKQFERRKGEREKPILAREK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR007287  Sof1  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF04158  Sof1  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
CDD cd00200  WD40  
Amino Acid Sequences MKIKALSRSVEEYQPPGSNAKKLPRNLDPAQHPMERAREYTKALNAVKLERMHAAPFVGQMGSGHIDGVYSMAKDPNSLKHMASGSGDGAIKAFDLTSRDEIWHTKSAHNNIVRSLCWTRDGKLLSAASDKTIKLWDPYNTPSDSAPISSWLGNSGFQSISHHRSRNAFAASSSSSEIAIYDLERHSAAPEVLRWPNATDTINTVSFNQVEQSILGSTGADRSIILWDVRTAMPLTKTTMTFTCNSLSWNPMEAFNFVVGSEDHNCYMFDMRKFDRALNVYKGHVAAVMSVEFSPTGEELVSGSYDRTVRIWNRDQGHSRDMYHTKRMQRVFTTMFTPDSKYILTGSDDGNVRVWRSNATDRSGIRSAKQRQALEYNEALISRYSHMPEVRRIKRHRHLPKVIKKAGEIKNVELQSIKRREENERRHTKKQFERRKGEREKPILAREK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.35
4 0.35
5 0.35
6 0.39
7 0.46
8 0.5
9 0.53
10 0.59
11 0.61
12 0.67
13 0.65
14 0.67
15 0.63
16 0.63
17 0.63
18 0.58
19 0.52
20 0.48
21 0.5
22 0.44
23 0.42
24 0.39
25 0.37
26 0.39
27 0.43
28 0.42
29 0.44
30 0.42
31 0.43
32 0.41
33 0.4
34 0.42
35 0.38
36 0.35
37 0.3
38 0.3
39 0.27
40 0.25
41 0.23
42 0.18
43 0.17
44 0.16
45 0.13
46 0.11
47 0.1
48 0.11
49 0.12
50 0.11
51 0.1
52 0.09
53 0.09
54 0.08
55 0.1
56 0.08
57 0.07
58 0.08
59 0.1
60 0.11
61 0.13
62 0.16
63 0.21
64 0.24
65 0.26
66 0.25
67 0.27
68 0.28
69 0.28
70 0.27
71 0.21
72 0.18
73 0.19
74 0.19
75 0.13
76 0.12
77 0.11
78 0.09
79 0.08
80 0.07
81 0.06
82 0.08
83 0.11
84 0.14
85 0.15
86 0.16
87 0.18
88 0.2
89 0.24
90 0.29
91 0.28
92 0.3
93 0.36
94 0.4
95 0.46
96 0.48
97 0.44
98 0.42
99 0.42
100 0.37
101 0.36
102 0.33
103 0.27
104 0.28
105 0.28
106 0.26
107 0.29
108 0.31
109 0.26
110 0.29
111 0.28
112 0.24
113 0.26
114 0.25
115 0.21
116 0.22
117 0.21
118 0.16
119 0.18
120 0.17
121 0.16
122 0.2
123 0.2
124 0.22
125 0.25
126 0.28
127 0.27
128 0.27
129 0.25
130 0.23
131 0.2
132 0.17
133 0.14
134 0.13
135 0.13
136 0.12
137 0.12
138 0.12
139 0.12
140 0.12
141 0.12
142 0.12
143 0.1
144 0.1
145 0.15
146 0.17
147 0.23
148 0.27
149 0.29
150 0.29
151 0.33
152 0.36
153 0.36
154 0.34
155 0.29
156 0.23
157 0.25
158 0.24
159 0.22
160 0.19
161 0.14
162 0.12
163 0.11
164 0.11
165 0.08
166 0.07
167 0.06
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.08
174 0.09
175 0.09
176 0.07
177 0.09
178 0.12
179 0.13
180 0.14
181 0.14
182 0.14
183 0.15
184 0.16
185 0.16
186 0.12
187 0.13
188 0.15
189 0.16
190 0.15
191 0.14
192 0.13
193 0.13
194 0.12
195 0.1
196 0.07
197 0.07
198 0.06
199 0.07
200 0.06
201 0.05
202 0.05
203 0.05
204 0.04
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.05
211 0.06
212 0.06
213 0.05
214 0.06
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.1
221 0.1
222 0.13
223 0.12
224 0.13
225 0.14
226 0.14
227 0.15
228 0.15
229 0.16
230 0.15
231 0.14
232 0.15
233 0.14
234 0.15
235 0.13
236 0.14
237 0.13
238 0.13
239 0.14
240 0.13
241 0.12
242 0.11
243 0.1
244 0.08
245 0.08
246 0.07
247 0.08
248 0.1
249 0.1
250 0.11
251 0.11
252 0.11
253 0.11
254 0.14
255 0.16
256 0.15
257 0.19
258 0.21
259 0.25
260 0.27
261 0.27
262 0.29
263 0.28
264 0.31
265 0.32
266 0.32
267 0.27
268 0.28
269 0.27
270 0.21
271 0.19
272 0.14
273 0.09
274 0.08
275 0.08
276 0.07
277 0.07
278 0.07
279 0.06
280 0.06
281 0.06
282 0.05
283 0.05
284 0.04
285 0.05
286 0.05
287 0.06
288 0.06
289 0.06
290 0.06
291 0.07
292 0.08
293 0.08
294 0.09
295 0.15
296 0.18
297 0.25
298 0.32
299 0.36
300 0.41
301 0.47
302 0.52
303 0.5
304 0.51
305 0.46
306 0.42
307 0.43
308 0.45
309 0.43
310 0.45
311 0.47
312 0.49
313 0.54
314 0.56
315 0.53
316 0.5
317 0.52
318 0.47
319 0.43
320 0.39
321 0.33
322 0.32
323 0.29
324 0.29
325 0.24
326 0.21
327 0.2
328 0.17
329 0.16
330 0.15
331 0.16
332 0.14
333 0.14
334 0.17
335 0.18
336 0.18
337 0.2
338 0.2
339 0.19
340 0.19
341 0.19
342 0.17
343 0.22
344 0.3
345 0.3
346 0.34
347 0.38
348 0.37
349 0.43
350 0.46
351 0.42
352 0.37
353 0.43
354 0.47
355 0.49
356 0.56
357 0.51
358 0.5
359 0.56
360 0.56
361 0.52
362 0.45
363 0.39
364 0.32
365 0.3
366 0.26
367 0.2
368 0.18
369 0.15
370 0.17
371 0.17
372 0.2
373 0.24
374 0.28
375 0.36
376 0.46
377 0.51
378 0.58
379 0.63
380 0.69
381 0.75
382 0.82
383 0.83
384 0.83
385 0.86
386 0.87
387 0.91
388 0.91
389 0.87
390 0.8
391 0.73
392 0.73
393 0.7
394 0.68
395 0.61
396 0.54
397 0.56
398 0.53
399 0.5
400 0.43
401 0.38
402 0.39
403 0.44
404 0.43
405 0.39
406 0.43
407 0.53
408 0.61
409 0.68
410 0.69
411 0.72
412 0.77
413 0.82
414 0.86
415 0.86
416 0.86
417 0.86
418 0.87
419 0.86
420 0.89
421 0.89
422 0.92
423 0.92
424 0.91
425 0.91
426 0.87
427 0.86
428 0.83