Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3Q355

Protein Details
Accession E3Q355   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPWRLSKFQKRRQRQRLRAVDDVVHydrophilic
76-105DKYTMFDRKEKKYRKGIHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKKYRKGIHKLP
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRVTSPLSSGLLWKIPWRLSKFQKRRQRQRLRAVDDVVATVDAALAKKGVTVAALERWKDEMPTEAEMLPRDKYTMFDRKEKKYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.19
5 0.21
6 0.24
7 0.31
8 0.35
9 0.42
10 0.49
11 0.6
12 0.68
13 0.73
14 0.8
15 0.84
16 0.89
17 0.92
18 0.93
19 0.91
20 0.92
21 0.92
22 0.88
23 0.82
24 0.73
25 0.64
26 0.52
27 0.42
28 0.32
29 0.21
30 0.14
31 0.08
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.1
45 0.12
46 0.12
47 0.13
48 0.15
49 0.14
50 0.14
51 0.14
52 0.12
53 0.13
54 0.14
55 0.15
56 0.14
57 0.15
58 0.16
59 0.17
60 0.15
61 0.13
62 0.12
63 0.11
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.44
70 0.52
71 0.63
72 0.69
73 0.71
74 0.72
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79