Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H8V0

Protein Details
Accession Q2H8V0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-42WKIPWRLSPTQKARQRKRLRAVDQVIHydrophilic
77-103KYTMFDRKAKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKRYRKGIHKLPK
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITSSLSGGLLWKIPWRLSPTQKARQRKRLRAVDQVIETVTNALAKKGETLKSLDRWKAEMPTEAEMLPRDKYTMFDRKAKRYRKGIHKLPKWTRVSQRINPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.15
5 0.15
6 0.16
7 0.19
8 0.25
9 0.31
10 0.38
11 0.47
12 0.52
13 0.6
14 0.68
15 0.75
16 0.78
17 0.81
18 0.85
19 0.84
20 0.86
21 0.86
22 0.83
23 0.82
24 0.77
25 0.72
26 0.62
27 0.53
28 0.43
29 0.32
30 0.27
31 0.17
32 0.12
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.09
39 0.12
40 0.13
41 0.13
42 0.16
43 0.19
44 0.24
45 0.29
46 0.29
47 0.27
48 0.27
49 0.28
50 0.28
51 0.26
52 0.24
53 0.22
54 0.22
55 0.22
56 0.19
57 0.19
58 0.17
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.62
72 0.69
73 0.71
74 0.71
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79