Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SID5

Protein Details
Accession C9SID5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-125DAERVTEKQRKKTQHFPQRKYAVKSAHydrophilic
NLS Segment(s)
PositionSequence
86-111AKQTRAIRRRLSKADAERVTEKQRKK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG val:VDBG_04817  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSKVKAAQLWGKNKEDLTKQLGELKTELGQLRIQKITSSGSKLNKIGDIRKSIARVLTVINAKQRHQLRLFYKNKKYAPLDLRAKQTRAIRRRLSKADAERVTEKQRKKTQHFPQRKYAVKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.52
4 0.47
5 0.44
6 0.41
7 0.37
8 0.35
9 0.39
10 0.39
11 0.35
12 0.31
13 0.28
14 0.23
15 0.24
16 0.23
17 0.17
18 0.19
19 0.2
20 0.23
21 0.23
22 0.21
23 0.18
24 0.19
25 0.21
26 0.21
27 0.23
28 0.24
29 0.26
30 0.3
31 0.31
32 0.3
33 0.31
34 0.31
35 0.31
36 0.3
37 0.31
38 0.29
39 0.31
40 0.31
41 0.28
42 0.26
43 0.21
44 0.17
45 0.14
46 0.16
47 0.15
48 0.15
49 0.19
50 0.2
51 0.2
52 0.26
53 0.28
54 0.29
55 0.3
56 0.36
57 0.36
58 0.45
59 0.53
60 0.56
61 0.61
62 0.64
63 0.63
64 0.63
65 0.6
66 0.58
67 0.54
68 0.54
69 0.55
70 0.52
71 0.59
72 0.57
73 0.55
74 0.51
75 0.54
76 0.54
77 0.53
78 0.58
79 0.58
80 0.62
81 0.69
82 0.71
83 0.69
84 0.68
85 0.68
86 0.69
87 0.63
88 0.59
89 0.55
90 0.54
91 0.58
92 0.57
93 0.55
94 0.56
95 0.61
96 0.66
97 0.7
98 0.76
99 0.77
100 0.81
101 0.86
102 0.83
103 0.85
104 0.85
105 0.85