Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2GYC8

Protein Details
Accession Q2GYC8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
200-227RTSRSRICSRTRPGCDPPRRPRCLPVRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024738  Hfi1/Tada1  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
Pfam View protein in Pfam  
PF12767  SAGA-Tad1  
Amino Acid Sequences MVDINPAALSRPSISLSTPVLSKQSINVSVPSIHKAPKTSQLIPARIDLEPIYTALKASIGTEQWPTYKESITNFLIGTALPSSAHAEFSERIEPILASPDGSKEHLHNQLIAAIYGNVTREMPDQGLAPWVSTNDKPSPATGSKPVSGDAAERRLKGEVMQLPARDRRRIKDLAHNDVSQGMRWSIAESMLTACLSLIRTSRSRICSRTRPGCDPPRRPRCLPVRAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.2
4 0.2
5 0.2
6 0.19
7 0.2
8 0.2
9 0.2
10 0.2
11 0.24
12 0.26
13 0.26
14 0.26
15 0.26
16 0.29
17 0.3
18 0.3
19 0.26
20 0.26
21 0.27
22 0.29
23 0.3
24 0.36
25 0.41
26 0.4
27 0.46
28 0.5
29 0.51
30 0.5
31 0.49
32 0.42
33 0.35
34 0.34
35 0.25
36 0.19
37 0.16
38 0.15
39 0.13
40 0.1
41 0.1
42 0.09
43 0.09
44 0.07
45 0.08
46 0.1
47 0.09
48 0.1
49 0.12
50 0.13
51 0.14
52 0.15
53 0.17
54 0.16
55 0.17
56 0.17
57 0.17
58 0.21
59 0.22
60 0.22
61 0.19
62 0.17
63 0.16
64 0.14
65 0.13
66 0.08
67 0.07
68 0.05
69 0.06
70 0.08
71 0.08
72 0.09
73 0.08
74 0.1
75 0.11
76 0.13
77 0.15
78 0.12
79 0.12
80 0.12
81 0.12
82 0.09
83 0.12
84 0.1
85 0.08
86 0.08
87 0.1
88 0.1
89 0.12
90 0.12
91 0.1
92 0.15
93 0.2
94 0.2
95 0.19
96 0.18
97 0.19
98 0.19
99 0.17
100 0.12
101 0.07
102 0.07
103 0.07
104 0.07
105 0.05
106 0.05
107 0.06
108 0.06
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.1
115 0.09
116 0.08
117 0.08
118 0.08
119 0.1
120 0.1
121 0.14
122 0.14
123 0.16
124 0.16
125 0.17
126 0.22
127 0.21
128 0.23
129 0.24
130 0.25
131 0.25
132 0.25
133 0.25
134 0.2
135 0.19
136 0.19
137 0.18
138 0.22
139 0.23
140 0.22
141 0.23
142 0.23
143 0.23
144 0.21
145 0.24
146 0.21
147 0.23
148 0.26
149 0.27
150 0.3
151 0.37
152 0.4
153 0.41
154 0.4
155 0.4
156 0.44
157 0.49
158 0.49
159 0.52
160 0.56
161 0.58
162 0.59
163 0.55
164 0.48
165 0.46
166 0.43
167 0.33
168 0.27
169 0.18
170 0.14
171 0.14
172 0.15
173 0.11
174 0.11
175 0.1
176 0.09
177 0.1
178 0.1
179 0.1
180 0.08
181 0.08
182 0.08
183 0.1
184 0.11
185 0.12
186 0.15
187 0.18
188 0.23
189 0.3
190 0.36
191 0.41
192 0.46
193 0.53
194 0.58
195 0.66
196 0.71
197 0.72
198 0.73
199 0.76
200 0.81
201 0.82
202 0.83
203 0.84
204 0.85
205 0.85
206 0.81
207 0.81
208 0.8
209 0.79