Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SCB9

Protein Details
Accession C9SCB9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65LFKRKVPARKWKRTAVDINDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, extr 5, E.R. 5, plas 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG val:VDBG_02843  -  
Amino Acid Sequences MLSTTGAHLGGKCGYVWAGTGFACFVLAFFFLPEMKDRSYREIDILFKRKVPARKWKRTAVDINDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.08
5 0.08
6 0.07
7 0.08
8 0.07
9 0.07
10 0.07
11 0.06
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.06
20 0.07
21 0.09
22 0.1
23 0.14
24 0.15
25 0.2
26 0.23
27 0.23
28 0.24
29 0.24
30 0.28
31 0.33
32 0.38
33 0.34
34 0.33
35 0.36
36 0.4
37 0.45
38 0.48
39 0.51
40 0.56
41 0.66
42 0.71
43 0.77
44 0.78
45 0.79
46 0.81
47 0.78