Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9S8Z5

Protein Details
Accession C9S8Z5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGRGKRRNANKQGRHSGPRSBasic
NLS Segment(s)
PositionSequence
5-11KRRNANK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
KEGG val:VDBG_01077  -  
Amino Acid Sequences MGRGKRRNANKQGRHSGPRSESWKSYAQVEKKHEKLQAYYDGLLQLPEEEREQFWDALKRELPNSFRFAGSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.74
4 0.67
5 0.64
6 0.6
7 0.54
8 0.48
9 0.45
10 0.47
11 0.39
12 0.41
13 0.4
14 0.39
15 0.42
16 0.47
17 0.5
18 0.48
19 0.52
20 0.49
21 0.43
22 0.4
23 0.37
24 0.36
25 0.31
26 0.28
27 0.24
28 0.21
29 0.2
30 0.18
31 0.14
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.13
39 0.16
40 0.16
41 0.18
42 0.23
43 0.24
44 0.28
45 0.31
46 0.29
47 0.29
48 0.35
49 0.36
50 0.34
51 0.38
52 0.35
53 0.33