Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SLJ6

Protein Details
Accession C9SLJ6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-75TPSPRWSLSRRCLRLPRPKKSTTWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 6, cyto_nucl 6, plas 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR002403  Cyt_P450_E_grp-IV  
IPR036396  Cyt_P450_sf  
IPR007577  GlycoTrfase_DXD_sugar-bd_CS  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:1901135  P:carbohydrate derivative metabolic process  
KEGG val:VDBG_05673  -  
Pfam View protein in Pfam  
PF04488  Gly_transf_sug  
PF00067  p450  
Amino Acid Sequences MNTNTSPHRGSGRAGSSTRSSSSSSSSHASGSGTHNQPYDEERLELLGEFDTPSPRWSLSRRCLRLPRPKKSTTWLLLIDLTIIGLLVIAFWPLITLLLYNERLFGARLALPVEKTPHTENHYQQHAIPRILHQTSATEQIRDDWVKPQQSCKDAYSDFEYMHWTDALARDLIATEYPWFLDTWDNYPFPIQHADSLRYFVLHRYGGIYLDMDTWCNASIPIHQIEAAGGKDLSVFKSTSPTGVSNDLMITTARHPIFEAVIKRLDELRAELLTLDPSFSSPSLEKSSTVPDSKALDALPLLHAVVMETLRLHAPIPGPEPRRTPPTGCCIAGYTISGDVRVACLAHTLHRDETAFPDPEHWASTRWFVEDGQKREMLPDSGHSAAAAGCVWAPILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.41
4 0.42
5 0.41
6 0.35
7 0.32
8 0.27
9 0.31
10 0.29
11 0.28
12 0.28
13 0.27
14 0.25
15 0.24
16 0.22
17 0.21
18 0.24
19 0.3
20 0.3
21 0.32
22 0.32
23 0.31
24 0.32
25 0.33
26 0.33
27 0.26
28 0.24
29 0.22
30 0.21
31 0.21
32 0.2
33 0.16
34 0.11
35 0.09
36 0.09
37 0.1
38 0.13
39 0.13
40 0.14
41 0.15
42 0.16
43 0.19
44 0.25
45 0.34
46 0.41
47 0.51
48 0.55
49 0.62
50 0.7
51 0.76
52 0.81
53 0.82
54 0.82
55 0.8
56 0.8
57 0.76
58 0.74
59 0.74
60 0.67
61 0.63
62 0.54
63 0.47
64 0.43
65 0.38
66 0.31
67 0.21
68 0.16
69 0.09
70 0.07
71 0.04
72 0.03
73 0.03
74 0.02
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.05
85 0.1
86 0.12
87 0.12
88 0.13
89 0.13
90 0.13
91 0.14
92 0.13
93 0.11
94 0.1
95 0.11
96 0.13
97 0.13
98 0.14
99 0.15
100 0.18
101 0.17
102 0.19
103 0.21
104 0.24
105 0.28
106 0.33
107 0.36
108 0.4
109 0.44
110 0.41
111 0.41
112 0.45
113 0.44
114 0.39
115 0.35
116 0.31
117 0.33
118 0.33
119 0.31
120 0.22
121 0.2
122 0.2
123 0.28
124 0.25
125 0.19
126 0.19
127 0.2
128 0.24
129 0.23
130 0.22
131 0.19
132 0.24
133 0.29
134 0.3
135 0.36
136 0.36
137 0.38
138 0.4
139 0.36
140 0.36
141 0.3
142 0.32
143 0.3
144 0.26
145 0.23
146 0.2
147 0.21
148 0.16
149 0.17
150 0.14
151 0.09
152 0.09
153 0.11
154 0.11
155 0.09
156 0.08
157 0.07
158 0.07
159 0.08
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.08
169 0.09
170 0.11
171 0.14
172 0.14
173 0.14
174 0.15
175 0.14
176 0.13
177 0.15
178 0.13
179 0.13
180 0.16
181 0.18
182 0.18
183 0.19
184 0.18
185 0.15
186 0.15
187 0.12
188 0.13
189 0.11
190 0.11
191 0.1
192 0.11
193 0.1
194 0.1
195 0.1
196 0.07
197 0.09
198 0.09
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.06
205 0.05
206 0.07
207 0.1
208 0.11
209 0.1
210 0.1
211 0.1
212 0.11
213 0.12
214 0.1
215 0.08
216 0.06
217 0.06
218 0.07
219 0.08
220 0.09
221 0.09
222 0.09
223 0.08
224 0.12
225 0.12
226 0.12
227 0.14
228 0.14
229 0.15
230 0.17
231 0.17
232 0.13
233 0.13
234 0.12
235 0.11
236 0.1
237 0.09
238 0.08
239 0.14
240 0.13
241 0.13
242 0.14
243 0.14
244 0.15
245 0.19
246 0.2
247 0.16
248 0.2
249 0.2
250 0.21
251 0.21
252 0.21
253 0.17
254 0.17
255 0.16
256 0.13
257 0.13
258 0.12
259 0.11
260 0.12
261 0.11
262 0.09
263 0.07
264 0.07
265 0.08
266 0.08
267 0.11
268 0.09
269 0.13
270 0.18
271 0.18
272 0.19
273 0.19
274 0.25
275 0.27
276 0.28
277 0.25
278 0.24
279 0.26
280 0.25
281 0.25
282 0.19
283 0.15
284 0.14
285 0.14
286 0.12
287 0.09
288 0.09
289 0.07
290 0.07
291 0.07
292 0.08
293 0.07
294 0.06
295 0.06
296 0.07
297 0.07
298 0.08
299 0.08
300 0.09
301 0.11
302 0.14
303 0.18
304 0.25
305 0.29
306 0.33
307 0.38
308 0.39
309 0.44
310 0.45
311 0.45
312 0.42
313 0.46
314 0.48
315 0.43
316 0.4
317 0.36
318 0.34
319 0.31
320 0.26
321 0.19
322 0.16
323 0.16
324 0.15
325 0.13
326 0.11
327 0.11
328 0.11
329 0.1
330 0.06
331 0.1
332 0.1
333 0.15
334 0.19
335 0.21
336 0.22
337 0.25
338 0.26
339 0.24
340 0.29
341 0.31
342 0.29
343 0.26
344 0.28
345 0.28
346 0.28
347 0.29
348 0.25
349 0.21
350 0.21
351 0.27
352 0.26
353 0.25
354 0.25
355 0.24
356 0.33
357 0.39
358 0.42
359 0.41
360 0.42
361 0.4
362 0.41
363 0.43
364 0.36
365 0.29
366 0.28
367 0.28
368 0.27
369 0.27
370 0.24
371 0.21
372 0.18
373 0.17
374 0.13
375 0.08
376 0.06
377 0.07