Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SS93

Protein Details
Accession C9SS93    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-35HTRTLFLVRKKRNSKHDVPCSLDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, mito 9, nucl 7
Family & Domain DBs
KEGG val:VDBG_07768  -  
Amino Acid Sequences MHNTPDATMPEDHTRTLFLVRKKRNSKHDVPCSLDCLLYPRGKPRRAPKTLFGRLLALLGVDLQTPASSGAGERWVHRGGAGYQPGRHWGCPRPNMFFEGSGEVAAVPAGGAGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.28
4 0.29
5 0.3
6 0.39
7 0.47
8 0.57
9 0.66
10 0.73
11 0.76
12 0.8
13 0.82
14 0.82
15 0.84
16 0.8
17 0.77
18 0.7
19 0.63
20 0.55
21 0.45
22 0.34
23 0.28
24 0.26
25 0.22
26 0.22
27 0.28
28 0.35
29 0.39
30 0.45
31 0.51
32 0.57
33 0.61
34 0.64
35 0.63
36 0.65
37 0.68
38 0.64
39 0.55
40 0.45
41 0.38
42 0.34
43 0.26
44 0.15
45 0.08
46 0.06
47 0.05
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.03
56 0.04
57 0.05
58 0.1
59 0.1
60 0.11
61 0.15
62 0.15
63 0.15
64 0.16
65 0.17
66 0.14
67 0.2
68 0.25
69 0.23
70 0.24
71 0.25
72 0.31
73 0.31
74 0.32
75 0.29
76 0.32
77 0.39
78 0.46
79 0.49
80 0.49
81 0.49
82 0.51
83 0.49
84 0.42
85 0.36
86 0.32
87 0.28
88 0.21
89 0.19
90 0.15
91 0.13
92 0.11
93 0.08
94 0.04