Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SJK1

Protein Details
Accession C9SJK1   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
100-122SAPDSRPRKKIVKRAPPPGGKTSHydrophilic
NLS Segment(s)
PositionSequence
86-126KLRLRPRAPRPDNSSAPDSRPRKKIVKRAPPPGGKTSARRG
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
KEGG val:VDBG_04472  -  
Amino Acid Sequences MLMPSAFSCDASQQHYQSYPHTRLQSALFASPPASPPTLASAPAIGNIFNTCRSLQSLLTTPPPPERAQLTQLPTPPMAHAPSPIKLRLRPRAPRPDNSSAPDSRPRKKIVKRAPPPGGKTSARRGADERTLAALDLPQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.31
4 0.34
5 0.4
6 0.4
7 0.41
8 0.43
9 0.4
10 0.39
11 0.4
12 0.38
13 0.32
14 0.29
15 0.23
16 0.2
17 0.2
18 0.19
19 0.18
20 0.16
21 0.14
22 0.13
23 0.13
24 0.18
25 0.18
26 0.18
27 0.16
28 0.15
29 0.14
30 0.16
31 0.15
32 0.09
33 0.09
34 0.09
35 0.1
36 0.09
37 0.11
38 0.09
39 0.1
40 0.12
41 0.13
42 0.13
43 0.14
44 0.16
45 0.16
46 0.19
47 0.19
48 0.19
49 0.19
50 0.22
51 0.2
52 0.19
53 0.21
54 0.19
55 0.22
56 0.25
57 0.26
58 0.26
59 0.27
60 0.27
61 0.24
62 0.22
63 0.19
64 0.16
65 0.14
66 0.12
67 0.14
68 0.15
69 0.18
70 0.2
71 0.23
72 0.24
73 0.27
74 0.35
75 0.4
76 0.47
77 0.52
78 0.58
79 0.67
80 0.69
81 0.73
82 0.73
83 0.73
84 0.68
85 0.64
86 0.6
87 0.51
88 0.5
89 0.52
90 0.5
91 0.49
92 0.5
93 0.52
94 0.56
95 0.63
96 0.69
97 0.7
98 0.75
99 0.77
100 0.82
101 0.86
102 0.84
103 0.81
104 0.76
105 0.73
106 0.66
107 0.63
108 0.62
109 0.61
110 0.55
111 0.52
112 0.5
113 0.49
114 0.51
115 0.48
116 0.4
117 0.34
118 0.33
119 0.3
120 0.27
121 0.23