Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SB87

Protein Details
Accession C9SB87    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-44KVKSQTPKVEKQEKKKVPKGRAKKRLTYTRRFBasic
NLS Segment(s)
PositionSequence
12-37GKVKSQTPKVEKQEKKKVPKGRAKKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG val:VDBG_01746  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKVPKGRAKKRLTYTRRFVNVQLTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.74
11 0.77
12 0.77
13 0.8
14 0.79
15 0.79
16 0.78
17 0.81
18 0.82
19 0.82
20 0.84
21 0.8
22 0.81
23 0.81
24 0.82
25 0.8
26 0.78
27 0.74
28 0.73
29 0.72
30 0.66
31 0.58
32 0.56
33 0.51
34 0.44
35 0.43
36 0.38
37 0.39
38 0.39
39 0.41
40 0.37
41 0.43
42 0.5
43 0.53