Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SHP1

Protein Details
Accession C9SHP1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
164-184RQDLRHPRGPRRDRRGPSLRLBasic
NLS Segment(s)
PositionSequence
166-201DLRHPRGPRRDRRGPSLRLVSAPDGEKVSKKAKKRA
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR035587  DUS-like_FMN-bd  
KEGG val:VDBG_04573  -  
Pfam View protein in Pfam  
PF01207  Dus  
Amino Acid Sequences MLSRSIGRFMASEVKKVPIPRRGVDYRGKVVLAPMVRSGELPSRLLALHYGADLVWGPETVDKAIIGTTRKVNPVTNTIDWTRIPSFGQKEPPPDAKEAVVFSTHAAKEAGRLIFQVGTADPDLAVQAARLVAGDVAGIDVNAGCPKPFSTHSGMGRAAPAHARQDLRHPRGPRRDRRGPSLRLVSAPDGEKVSKKAKKRANASALAAGGNTGQDRANQAVKTMSARGVQKPAELPQAAVALPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.39
4 0.43
5 0.41
6 0.46
7 0.45
8 0.52
9 0.54
10 0.57
11 0.6
12 0.59
13 0.56
14 0.53
15 0.49
16 0.41
17 0.37
18 0.36
19 0.29
20 0.23
21 0.2
22 0.19
23 0.19
24 0.19
25 0.2
26 0.21
27 0.22
28 0.21
29 0.19
30 0.19
31 0.19
32 0.19
33 0.17
34 0.12
35 0.1
36 0.09
37 0.09
38 0.07
39 0.08
40 0.08
41 0.07
42 0.06
43 0.05
44 0.06
45 0.07
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.08
52 0.1
53 0.11
54 0.13
55 0.17
56 0.2
57 0.23
58 0.24
59 0.26
60 0.27
61 0.31
62 0.34
63 0.3
64 0.31
65 0.3
66 0.31
67 0.28
68 0.29
69 0.24
70 0.19
71 0.19
72 0.21
73 0.24
74 0.25
75 0.32
76 0.3
77 0.33
78 0.37
79 0.42
80 0.39
81 0.37
82 0.34
83 0.28
84 0.27
85 0.23
86 0.19
87 0.13
88 0.11
89 0.1
90 0.14
91 0.13
92 0.13
93 0.12
94 0.11
95 0.12
96 0.16
97 0.16
98 0.1
99 0.11
100 0.11
101 0.1
102 0.11
103 0.1
104 0.06
105 0.07
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.03
126 0.02
127 0.02
128 0.03
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.08
135 0.1
136 0.14
137 0.19
138 0.25
139 0.28
140 0.31
141 0.31
142 0.29
143 0.28
144 0.24
145 0.19
146 0.15
147 0.15
148 0.14
149 0.17
150 0.18
151 0.17
152 0.27
153 0.37
154 0.41
155 0.46
156 0.49
157 0.55
158 0.64
159 0.74
160 0.74
161 0.73
162 0.77
163 0.75
164 0.8
165 0.8
166 0.74
167 0.72
168 0.69
169 0.61
170 0.53
171 0.51
172 0.43
173 0.37
174 0.33
175 0.27
176 0.21
177 0.21
178 0.22
179 0.23
180 0.31
181 0.33
182 0.39
183 0.47
184 0.53
185 0.61
186 0.67
187 0.73
188 0.71
189 0.71
190 0.67
191 0.62
192 0.55
193 0.46
194 0.37
195 0.27
196 0.19
197 0.14
198 0.11
199 0.08
200 0.07
201 0.08
202 0.12
203 0.15
204 0.2
205 0.19
206 0.2
207 0.21
208 0.23
209 0.25
210 0.24
211 0.23
212 0.24
213 0.28
214 0.31
215 0.36
216 0.35
217 0.35
218 0.37
219 0.38
220 0.4
221 0.37
222 0.33
223 0.29
224 0.3