Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2GXW9

Protein Details
Accession Q2GXW9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-42GNLPHRPPFRRSRRPLILPPLHRBasic
NLS Segment(s)
PositionSequence
24-44HRPPFRRSRRPLILPPLHRRP
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004480  Monothiol_GRX-rel  
IPR036249  Thioredoxin-like_sf  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
Amino Acid Sequences MTGPFLKGTGQIYPAKRLLGNLPHRPPFRRSRRPLILPPLHRRPAPPPLGWCPPGHRQGRRVGPSSAVHEGHTRDAPVRLLAREYPGAGSAGRQPGEVCGIQCPGIKEYSDWPTIPQLYIDKEFVGGCDIIVSMHQNGELAKMLEEKGVLVKEEGAAEGGGEAGVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.32
4 0.31
5 0.33
6 0.36
7 0.43
8 0.47
9 0.52
10 0.58
11 0.62
12 0.64
13 0.63
14 0.64
15 0.66
16 0.68
17 0.68
18 0.71
19 0.77
20 0.81
21 0.82
22 0.82
23 0.8
24 0.78
25 0.79
26 0.78
27 0.72
28 0.65
29 0.6
30 0.55
31 0.55
32 0.52
33 0.46
34 0.42
35 0.44
36 0.49
37 0.48
38 0.44
39 0.39
40 0.4
41 0.46
42 0.47
43 0.45
44 0.43
45 0.5
46 0.57
47 0.57
48 0.54
49 0.46
50 0.43
51 0.41
52 0.41
53 0.37
54 0.28
55 0.24
56 0.23
57 0.24
58 0.21
59 0.2
60 0.16
61 0.13
62 0.13
63 0.13
64 0.13
65 0.13
66 0.11
67 0.12
68 0.12
69 0.13
70 0.12
71 0.12
72 0.1
73 0.09
74 0.09
75 0.08
76 0.08
77 0.09
78 0.12
79 0.12
80 0.12
81 0.11
82 0.11
83 0.14
84 0.14
85 0.11
86 0.09
87 0.1
88 0.11
89 0.13
90 0.14
91 0.12
92 0.13
93 0.13
94 0.12
95 0.16
96 0.19
97 0.2
98 0.18
99 0.19
100 0.22
101 0.22
102 0.21
103 0.19
104 0.17
105 0.18
106 0.2
107 0.2
108 0.16
109 0.16
110 0.16
111 0.14
112 0.14
113 0.1
114 0.08
115 0.07
116 0.07
117 0.06
118 0.07
119 0.09
120 0.07
121 0.07
122 0.08
123 0.08
124 0.08
125 0.1
126 0.11
127 0.1
128 0.1
129 0.12
130 0.12
131 0.13
132 0.13
133 0.11
134 0.13
135 0.13
136 0.13
137 0.12
138 0.12
139 0.13
140 0.13
141 0.13
142 0.1
143 0.09
144 0.08
145 0.08
146 0.07