Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9S7Z4

Protein Details
Accession C9S7Z4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAVPPAPRPHRKRKTPDRWWRISDEHydrophilic
NLS Segment(s)
PositionSequence
7-16PRPHRKRKTP
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
KEGG val:VDBG_01393  -  
Amino Acid Sequences MAVPPAPRPHRKRKTPDRWWRISDEKIREAKTGEVLGMQREVYLLFYELDKDDDGGGDGGGGGDAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.94
4 0.92
5 0.89
6 0.83
7 0.79
8 0.74
9 0.7
10 0.67
11 0.62
12 0.6
13 0.57
14 0.54
15 0.48
16 0.43
17 0.36
18 0.3
19 0.24
20 0.16
21 0.13
22 0.12
23 0.11
24 0.11
25 0.1
26 0.07
27 0.07
28 0.07
29 0.06
30 0.06
31 0.07
32 0.06
33 0.07
34 0.08
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.1
42 0.09
43 0.08
44 0.06
45 0.06
46 0.05