Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9S5H0

Protein Details
Accession C9S5H0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
124-161RANNTKKLARLQKRHERPGLKRKRLRSERWRARFKIGFBasic
NLS Segment(s)
PositionSequence
129-158KKLARLQKRHERPGLKRKRLRSERWRARFK
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG val:VDBG_01156  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MTTRTPPVPWSQPRPFSSSAPTSPAQNASAVPRPPASTPRAAGGFAPATAASKSAASDHVYDATSTDTLDLSKIIAAESDDFLRSHYSAPKPELRLKPVLGRTFHCTPRRDMAGALAVLGSAMRANNTKKLARLQKRHERPGLKRKRLRSERWRARFKIGFAATVSRVQELRNQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.64
3 0.57
4 0.55
5 0.53
6 0.46
7 0.42
8 0.4
9 0.36
10 0.35
11 0.35
12 0.29
13 0.23
14 0.22
15 0.22
16 0.28
17 0.26
18 0.26
19 0.25
20 0.26
21 0.27
22 0.31
23 0.3
24 0.28
25 0.28
26 0.3
27 0.3
28 0.28
29 0.26
30 0.24
31 0.2
32 0.15
33 0.15
34 0.11
35 0.11
36 0.1
37 0.11
38 0.08
39 0.07
40 0.08
41 0.08
42 0.1
43 0.1
44 0.11
45 0.12
46 0.13
47 0.13
48 0.13
49 0.12
50 0.12
51 0.1
52 0.08
53 0.08
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.09
72 0.09
73 0.14
74 0.15
75 0.17
76 0.21
77 0.25
78 0.27
79 0.35
80 0.37
81 0.36
82 0.37
83 0.36
84 0.39
85 0.4
86 0.41
87 0.35
88 0.34
89 0.36
90 0.38
91 0.44
92 0.44
93 0.4
94 0.39
95 0.43
96 0.43
97 0.38
98 0.33
99 0.27
100 0.25
101 0.22
102 0.19
103 0.13
104 0.1
105 0.09
106 0.08
107 0.06
108 0.03
109 0.03
110 0.04
111 0.08
112 0.1
113 0.16
114 0.2
115 0.22
116 0.25
117 0.34
118 0.43
119 0.5
120 0.58
121 0.63
122 0.7
123 0.78
124 0.84
125 0.84
126 0.82
127 0.83
128 0.84
129 0.85
130 0.85
131 0.83
132 0.84
133 0.86
134 0.87
135 0.87
136 0.87
137 0.88
138 0.88
139 0.9
140 0.91
141 0.84
142 0.83
143 0.78
144 0.7
145 0.68
146 0.59
147 0.51
148 0.43
149 0.44
150 0.37
151 0.36
152 0.34
153 0.26
154 0.25
155 0.23
156 0.28