Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QZY5

Protein Details
Accession C4QZY5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-72DLSPINKEKKRVSKPKNKVRRRKFDSWDYVFIHydrophilic
NLS Segment(s)
PositionSequence
47-63KEKKRVSKPKNKVRRRK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, plas 5, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ppa:PAS_chr2-1_0201  -  
Amino Acid Sequences MTETSKSSHYRKASFSPYEDTKSKLAADLEKLAASSEQGDDLSPINKEKKRVSKPKNKVRRRKFDSWDYVFIVIIMFASCGIIYNLFRGPRIIFTTQKDLDTALSEIVKPVVTYTNDGVPTSTDTAGQSLTNKDEDQTRFDVAKEFRAIGEISPLIILTTNDNESEQLKKTISLYSITPQPALVAVNRHPHVEKLTSYINSLAAPQGSSSSTSNLPEEAVPGIVINGVPVASAKEIVLLHSAGKLNEFLSRKSQGRYRIEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.58
4 0.56
5 0.57
6 0.54
7 0.49
8 0.42
9 0.39
10 0.35
11 0.31
12 0.29
13 0.26
14 0.28
15 0.29
16 0.28
17 0.26
18 0.26
19 0.23
20 0.19
21 0.16
22 0.13
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.11
29 0.12
30 0.11
31 0.15
32 0.23
33 0.25
34 0.31
35 0.38
36 0.48
37 0.57
38 0.67
39 0.73
40 0.76
41 0.84
42 0.9
43 0.93
44 0.93
45 0.93
46 0.93
47 0.94
48 0.91
49 0.91
50 0.87
51 0.87
52 0.86
53 0.81
54 0.75
55 0.66
56 0.57
57 0.47
58 0.39
59 0.28
60 0.17
61 0.11
62 0.07
63 0.04
64 0.03
65 0.04
66 0.03
67 0.04
68 0.04
69 0.06
70 0.06
71 0.08
72 0.11
73 0.11
74 0.12
75 0.13
76 0.13
77 0.15
78 0.19
79 0.2
80 0.22
81 0.24
82 0.32
83 0.32
84 0.31
85 0.29
86 0.24
87 0.21
88 0.19
89 0.16
90 0.1
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.06
97 0.06
98 0.09
99 0.09
100 0.11
101 0.12
102 0.15
103 0.15
104 0.15
105 0.15
106 0.12
107 0.13
108 0.13
109 0.12
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.09
118 0.1
119 0.09
120 0.09
121 0.15
122 0.15
123 0.18
124 0.19
125 0.19
126 0.18
127 0.19
128 0.24
129 0.19
130 0.21
131 0.19
132 0.17
133 0.15
134 0.16
135 0.16
136 0.11
137 0.13
138 0.09
139 0.08
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.05
146 0.07
147 0.08
148 0.08
149 0.08
150 0.09
151 0.1
152 0.13
153 0.13
154 0.13
155 0.13
156 0.14
157 0.15
158 0.16
159 0.16
160 0.15
161 0.15
162 0.16
163 0.21
164 0.21
165 0.2
166 0.17
167 0.16
168 0.15
169 0.15
170 0.13
171 0.12
172 0.15
173 0.22
174 0.23
175 0.25
176 0.25
177 0.25
178 0.28
179 0.27
180 0.24
181 0.21
182 0.25
183 0.24
184 0.24
185 0.24
186 0.21
187 0.18
188 0.18
189 0.15
190 0.11
191 0.1
192 0.09
193 0.09
194 0.09
195 0.12
196 0.12
197 0.13
198 0.15
199 0.16
200 0.17
201 0.16
202 0.16
203 0.14
204 0.14
205 0.12
206 0.1
207 0.09
208 0.08
209 0.07
210 0.07
211 0.06
212 0.05
213 0.05
214 0.04
215 0.04
216 0.04
217 0.06
218 0.06
219 0.07
220 0.07
221 0.1
222 0.11
223 0.12
224 0.14
225 0.13
226 0.13
227 0.16
228 0.18
229 0.15
230 0.16
231 0.16
232 0.14
233 0.21
234 0.23
235 0.21
236 0.26
237 0.33
238 0.36
239 0.41
240 0.46
241 0.49