Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SGA9

Protein Details
Accession C9SGA9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHVKPIRCSNCSHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHVK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG val:VDBG_03558  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQVLRLLRHSRQDCPCPLRRRPPQPCPSSSRPLQQGRQEDCPHPGRQDHHCLNGACHVWEEAQRMNTAKSLFRLMNHETDHGRMGRCLGIGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.86
4 0.84
5 0.83
6 0.84
7 0.84
8 0.81
9 0.74
10 0.73
11 0.71
12 0.71
13 0.7
14 0.68
15 0.66
16 0.67
17 0.7
18 0.71
19 0.73
20 0.73
21 0.74
22 0.75
23 0.77
24 0.74
25 0.75
26 0.71
27 0.71
28 0.63
29 0.55
30 0.49
31 0.4
32 0.37
33 0.3
34 0.27
35 0.18
36 0.16
37 0.13
38 0.12
39 0.11
40 0.09
41 0.09
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.09
51 0.08
52 0.08
53 0.09
54 0.11
55 0.15
56 0.17
57 0.2
58 0.21
59 0.27
60 0.28
61 0.29
62 0.32
63 0.33
64 0.32
65 0.36
66 0.36
67 0.36
68 0.39
69 0.43
70 0.42
71 0.43
72 0.49
73 0.49
74 0.53
75 0.57
76 0.61
77 0.67
78 0.72
79 0.76
80 0.77
81 0.76
82 0.75
83 0.73
84 0.7
85 0.66
86 0.6
87 0.55
88 0.54
89 0.54
90 0.55
91 0.53
92 0.56
93 0.53
94 0.58
95 0.56
96 0.49
97 0.49
98 0.48
99 0.43
100 0.37
101 0.36
102 0.33
103 0.36
104 0.44
105 0.41
106 0.42
107 0.45
108 0.43
109 0.4
110 0.42
111 0.37
112 0.27
113 0.25
114 0.21
115 0.17
116 0.19
117 0.21
118 0.18
119 0.19
120 0.2
121 0.21
122 0.22
123 0.24
124 0.23
125 0.22
126 0.21
127 0.25
128 0.24
129 0.25
130 0.3
131 0.3
132 0.35
133 0.35
134 0.36
135 0.33
136 0.33
137 0.36
138 0.33
139 0.31
140 0.25
141 0.25
142 0.23