Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SD40

Protein Details
Accession C9SD40    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-32GATNNVLRQRRSRRNTPKFVGRPRHNLARRHydrophilic
NLS Segment(s)
PositionSequence
14-20SRRNTPK
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
KEGG val:VDBG_03114  -  
Amino Acid Sequences MDGATNNVLRQRRSRRNTPKFVGRPRHNLARRQVPPPQPVPTVPGSESNSDVTVPSVPGAPDSDSDSGNEATQPLPPGVVPPPGAVPPGVAPPPVAQVDSSDDGADSGNEQLQPAPLPPPGFPTNGAAPQLGRQPVGRYLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.82
4 0.88
5 0.87
6 0.87
7 0.86
8 0.88
9 0.88
10 0.84
11 0.82
12 0.79
13 0.82
14 0.77
15 0.74
16 0.72
17 0.72
18 0.68
19 0.65
20 0.67
21 0.63
22 0.64
23 0.6
24 0.57
25 0.48
26 0.45
27 0.43
28 0.37
29 0.32
30 0.27
31 0.28
32 0.26
33 0.25
34 0.25
35 0.22
36 0.2
37 0.18
38 0.17
39 0.12
40 0.1
41 0.09
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.11
50 0.12
51 0.11
52 0.11
53 0.13
54 0.12
55 0.11
56 0.1
57 0.08
58 0.07
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.1
67 0.09
68 0.09
69 0.1
70 0.11
71 0.11
72 0.1
73 0.09
74 0.08
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.12
81 0.12
82 0.12
83 0.09
84 0.1
85 0.14
86 0.15
87 0.15
88 0.12
89 0.12
90 0.12
91 0.12
92 0.1
93 0.07
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.09
100 0.1
101 0.1
102 0.12
103 0.13
104 0.14
105 0.14
106 0.2
107 0.22
108 0.23
109 0.23
110 0.25
111 0.27
112 0.29
113 0.31
114 0.25
115 0.23
116 0.25
117 0.29
118 0.27
119 0.23
120 0.22
121 0.24
122 0.3