Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SHT2

Protein Details
Accession C9SHT2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
277-301SPALCRCRSTPPPCRNRAPHRRTVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 12.166, cyto 10.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR042098  TauD-like_sf  
IPR003819  TauD/TfdA-like  
Gene Ontology GO:0051213  F:dioxygenase activity  
KEGG val:VDBG_04614  -  
Pfam View protein in Pfam  
PF02668  TauD  
Amino Acid Sequences MPSAMPSPTVRPLSSQGDGSSLGAIIADMDIENLSDADFNVIQDALYHHQVVVFKKQGHLSPKAQYEVTQRFDPAAAGAYGHSKTLDAKRSILHPDLKTIPHQPQVQVIGNGFVESYEGLENITLRHPHHRTFHATRIPDEDDLDFTRYYRWHIDAALYGLAPPVATSLLAVRVPGGRSQTLRYDDGTGDEKTVPLGTTAFVSGAAMYEALSSEDQAFCRSTKVEYAPHPYVWMSGARSRSDGLGLVSEGRELPLSDLPPVDADRSRSCPCSGVTPSPALCRCRSTPPPCRNRAPHRRTVLDDLAEVREIVHRLQRARHCARKGGTPHDWEEGDFVIFHNRGVLHSVVGAFAEHEVRLFRQCNIAGSALPVGPEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.3
4 0.29
5 0.29
6 0.26
7 0.21
8 0.14
9 0.12
10 0.09
11 0.08
12 0.06
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.08
25 0.09
26 0.09
27 0.1
28 0.1
29 0.09
30 0.1
31 0.13
32 0.13
33 0.15
34 0.15
35 0.14
36 0.17
37 0.21
38 0.23
39 0.29
40 0.31
41 0.3
42 0.34
43 0.38
44 0.41
45 0.43
46 0.47
47 0.44
48 0.45
49 0.49
50 0.48
51 0.45
52 0.43
53 0.45
54 0.46
55 0.45
56 0.4
57 0.35
58 0.33
59 0.33
60 0.3
61 0.21
62 0.16
63 0.11
64 0.09
65 0.09
66 0.12
67 0.12
68 0.12
69 0.11
70 0.1
71 0.14
72 0.21
73 0.28
74 0.26
75 0.28
76 0.3
77 0.34
78 0.38
79 0.39
80 0.4
81 0.33
82 0.36
83 0.38
84 0.38
85 0.38
86 0.38
87 0.37
88 0.37
89 0.39
90 0.34
91 0.34
92 0.38
93 0.37
94 0.34
95 0.29
96 0.24
97 0.21
98 0.2
99 0.15
100 0.1
101 0.07
102 0.06
103 0.07
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.09
111 0.11
112 0.12
113 0.2
114 0.23
115 0.28
116 0.33
117 0.36
118 0.42
119 0.45
120 0.52
121 0.5
122 0.49
123 0.46
124 0.46
125 0.44
126 0.36
127 0.32
128 0.24
129 0.19
130 0.19
131 0.2
132 0.15
133 0.13
134 0.14
135 0.14
136 0.16
137 0.16
138 0.16
139 0.15
140 0.15
141 0.16
142 0.15
143 0.16
144 0.14
145 0.11
146 0.09
147 0.08
148 0.07
149 0.06
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.04
156 0.06
157 0.06
158 0.06
159 0.06
160 0.08
161 0.08
162 0.1
163 0.11
164 0.11
165 0.12
166 0.15
167 0.19
168 0.2
169 0.21
170 0.2
171 0.2
172 0.19
173 0.2
174 0.21
175 0.16
176 0.14
177 0.13
178 0.12
179 0.1
180 0.11
181 0.08
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.04
199 0.05
200 0.06
201 0.06
202 0.07
203 0.08
204 0.09
205 0.08
206 0.1
207 0.1
208 0.1
209 0.13
210 0.16
211 0.19
212 0.22
213 0.3
214 0.31
215 0.3
216 0.3
217 0.27
218 0.24
219 0.21
220 0.19
221 0.14
222 0.15
223 0.18
224 0.18
225 0.19
226 0.19
227 0.18
228 0.16
229 0.15
230 0.11
231 0.09
232 0.09
233 0.09
234 0.08
235 0.08
236 0.07
237 0.07
238 0.07
239 0.06
240 0.08
241 0.1
242 0.1
243 0.11
244 0.11
245 0.11
246 0.12
247 0.13
248 0.13
249 0.12
250 0.15
251 0.18
252 0.24
253 0.26
254 0.27
255 0.27
256 0.27
257 0.26
258 0.3
259 0.31
260 0.3
261 0.31
262 0.32
263 0.32
264 0.36
265 0.4
266 0.36
267 0.33
268 0.34
269 0.34
270 0.39
271 0.48
272 0.51
273 0.57
274 0.64
275 0.72
276 0.74
277 0.8
278 0.81
279 0.82
280 0.85
281 0.82
282 0.81
283 0.79
284 0.77
285 0.73
286 0.71
287 0.65
288 0.55
289 0.49
290 0.42
291 0.35
292 0.31
293 0.25
294 0.18
295 0.15
296 0.15
297 0.15
298 0.18
299 0.2
300 0.23
301 0.31
302 0.38
303 0.45
304 0.54
305 0.61
306 0.6
307 0.64
308 0.64
309 0.65
310 0.64
311 0.63
312 0.61
313 0.58
314 0.57
315 0.54
316 0.52
317 0.43
318 0.38
319 0.3
320 0.23
321 0.18
322 0.15
323 0.17
324 0.16
325 0.16
326 0.17
327 0.16
328 0.16
329 0.2
330 0.2
331 0.13
332 0.15
333 0.15
334 0.12
335 0.12
336 0.11
337 0.08
338 0.09
339 0.1
340 0.08
341 0.09
342 0.11
343 0.12
344 0.19
345 0.2
346 0.2
347 0.26
348 0.27
349 0.3
350 0.31
351 0.31
352 0.25
353 0.26
354 0.27
355 0.2
356 0.19