Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9S5G5

Protein Details
Accession C9S5G5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-73QSLIRRQRQRWLKYRAPLRSMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, extr 3, cyto 2
Family & Domain DBs
KEGG val:VDBG_01151  -  
Amino Acid Sequences MTITGTVPRASKNPHTPLAVSLAQRALALAALAAPRVSVSRTMTTGTALKGFQSLIRRQRQRWLKYRAPLRSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.47
4 0.44
5 0.44
6 0.39
7 0.3
8 0.26
9 0.22
10 0.19
11 0.18
12 0.16
13 0.11
14 0.07
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.04
23 0.04
24 0.05
25 0.06
26 0.08
27 0.1
28 0.11
29 0.12
30 0.12
31 0.14
32 0.15
33 0.14
34 0.13
35 0.12
36 0.11
37 0.11
38 0.11
39 0.13
40 0.17
41 0.24
42 0.31
43 0.41
44 0.48
45 0.49
46 0.59
47 0.66
48 0.7
49 0.72
50 0.73
51 0.71
52 0.75
53 0.82