Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SNY5

Protein Details
Accession C9SNY5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAGQRVTYRRRNPYNTRSNRTRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG val:VDBG_06610  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAGQRVTYRRRNPYNTRSNRTRIIKTPGGAHRVLHVKKRGTAPKCGDCGTKLPGIPALRPREYSQISKPQKTVQRAYGGSRCGNCVRDRVVRAFLIEEQKIVKKVLKEAGQSEKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.85
4 0.83
5 0.8
6 0.8
7 0.77
8 0.72
9 0.68
10 0.66
11 0.62
12 0.56
13 0.58
14 0.54
15 0.51
16 0.46
17 0.39
18 0.36
19 0.4
20 0.41
21 0.39
22 0.4
23 0.38
24 0.42
25 0.5
26 0.54
27 0.48
28 0.54
29 0.54
30 0.54
31 0.54
32 0.51
33 0.44
34 0.37
35 0.37
36 0.31
37 0.26
38 0.2
39 0.18
40 0.2
41 0.2
42 0.2
43 0.24
44 0.26
45 0.24
46 0.26
47 0.27
48 0.3
49 0.32
50 0.33
51 0.32
52 0.38
53 0.42
54 0.43
55 0.43
56 0.43
57 0.47
58 0.49
59 0.49
60 0.43
61 0.45
62 0.44
63 0.47
64 0.45
65 0.41
66 0.39
67 0.35
68 0.34
69 0.3
70 0.31
71 0.28
72 0.27
73 0.29
74 0.33
75 0.35
76 0.35
77 0.36
78 0.34
79 0.33
80 0.32
81 0.31
82 0.3
83 0.27
84 0.24
85 0.24
86 0.27
87 0.28
88 0.27
89 0.27
90 0.23
91 0.29
92 0.36
93 0.38
94 0.39
95 0.43
96 0.52