Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GUC3

Protein Details
Accession Q2GUC3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-56PTGASSRRRRLPRRPKLCSRNSAVHydrophilic
NLS Segment(s)
PositionSequence
39-47RRRRLPRRP
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MWFFETGRGDCGWSYILHQRLSRSDTNVYEAAPTGASSRRRRLPRRPKLCSRNSAVKTRCVAVTTVLRPRPMLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.24
4 0.26
5 0.27
6 0.29
7 0.31
8 0.36
9 0.35
10 0.32
11 0.32
12 0.29
13 0.32
14 0.29
15 0.26
16 0.21
17 0.18
18 0.15
19 0.11
20 0.1
21 0.07
22 0.11
23 0.18
24 0.21
25 0.26
26 0.33
27 0.42
28 0.49
29 0.59
30 0.66
31 0.71
32 0.78
33 0.81
34 0.85
35 0.86
36 0.87
37 0.83
38 0.79
39 0.78
40 0.72
41 0.73
42 0.65
43 0.62
44 0.56
45 0.51
46 0.45
47 0.36
48 0.32
49 0.27
50 0.33
51 0.32
52 0.38
53 0.4
54 0.4