Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SA19

Protein Details
Accession C9SA19    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
118-146GASFRHPRPHPRRPGRRRGGRQRRPAAVABasic
NLS Segment(s)
PositionSequence
118-143GASFRHPRPHPRRPGRRRGGRQRRPA
168-171LRRH
181-187GAGPAGK
Subcellular Location(s) nucl 8mito 8mito_nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
IPR017937  Thioredoxin_CS  
IPR013766  Thioredoxin_domain  
KEGG val:VDBG_02341  -  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS00194  THIOREDOXIN_1  
PS51352  THIOREDOXIN_2  
CDD cd02947  TRX_family  
Amino Acid Sequences MSGLISIQSPSQWQDVLNSTNVVVADFYADWCGPCKAIAPHFEKMANEYSKPKKAAFCKINVDTQSTISRAHGVSAMPTFVIFHAGKPIETIRGANPPALANAVANAMKLPDKTKTGGASFRHPRPHPRRPGRRRGGRQRRPAAVAALQLGLRYRLDPAPPLHHRGPLRRHARCTRDAARGAGPAGKTRAPPARPLGLQDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.23
4 0.23
5 0.21
6 0.19
7 0.2
8 0.2
9 0.16
10 0.11
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.1
17 0.1
18 0.12
19 0.13
20 0.11
21 0.11
22 0.14
23 0.16
24 0.21
25 0.29
26 0.32
27 0.34
28 0.36
29 0.38
30 0.34
31 0.33
32 0.36
33 0.31
34 0.27
35 0.33
36 0.37
37 0.42
38 0.44
39 0.43
40 0.43
41 0.46
42 0.55
43 0.52
44 0.51
45 0.53
46 0.53
47 0.57
48 0.51
49 0.48
50 0.39
51 0.36
52 0.32
53 0.25
54 0.23
55 0.17
56 0.18
57 0.15
58 0.14
59 0.13
60 0.11
61 0.11
62 0.11
63 0.11
64 0.08
65 0.08
66 0.07
67 0.06
68 0.11
69 0.09
70 0.09
71 0.13
72 0.14
73 0.14
74 0.14
75 0.15
76 0.12
77 0.12
78 0.13
79 0.1
80 0.14
81 0.15
82 0.14
83 0.15
84 0.13
85 0.13
86 0.12
87 0.11
88 0.06
89 0.06
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.07
97 0.08
98 0.09
99 0.11
100 0.12
101 0.14
102 0.16
103 0.18
104 0.23
105 0.24
106 0.31
107 0.35
108 0.39
109 0.45
110 0.44
111 0.53
112 0.57
113 0.65
114 0.67
115 0.72
116 0.78
117 0.8
118 0.89
119 0.89
120 0.91
121 0.91
122 0.92
123 0.92
124 0.91
125 0.92
126 0.89
127 0.83
128 0.76
129 0.67
130 0.59
131 0.49
132 0.41
133 0.31
134 0.24
135 0.19
136 0.16
137 0.15
138 0.12
139 0.1
140 0.09
141 0.11
142 0.12
143 0.13
144 0.17
145 0.2
146 0.28
147 0.32
148 0.39
149 0.38
150 0.42
151 0.46
152 0.5
153 0.55
154 0.55
155 0.62
156 0.62
157 0.69
158 0.72
159 0.74
160 0.72
161 0.73
162 0.7
163 0.68
164 0.65
165 0.59
166 0.53
167 0.48
168 0.43
169 0.38
170 0.32
171 0.28
172 0.28
173 0.28
174 0.26
175 0.31
176 0.38
177 0.36
178 0.41
179 0.43
180 0.47
181 0.46
182 0.49