Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TDV7

Protein Details
Accession A7TDV7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ASSLPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
9-27KIVKKHTKKFKRHHSDRYH
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vpo:Kpol_1018p110  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASSLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFLAPSGHKTFLIANIKDLEMLTMHTKSYAAEIAHNISSRNRVTILARAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.56
24 0.52
25 0.49
26 0.46
27 0.46
28 0.53
29 0.62
30 0.66
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.24
51 0.26
52 0.29
53 0.28
54 0.32
55 0.3
56 0.39
57 0.43
58 0.43
59 0.41
60 0.38
61 0.35
62 0.33
63 0.34
64 0.26
65 0.22
66 0.22
67 0.22
68 0.21
69 0.21
70 0.14
71 0.07
72 0.09
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.18
87 0.17
88 0.16
89 0.21
90 0.2
91 0.2
92 0.18
93 0.18
94 0.2
95 0.27
96 0.33
97 0.31
98 0.31
99 0.3
100 0.3
101 0.3
102 0.28
103 0.25
104 0.19
105 0.21
106 0.3
107 0.38
108 0.42
109 0.41
110 0.43
111 0.42