Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SN18

Protein Details
Accession C9SN18    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-43NLARNTPSARPPKKKSRAIPRLKKTKKKAEEEADHydrophilic
NLS Segment(s)
PositionSequence
18-38ARPPKKKSRAIPRLKKTKKKA
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
KEGG val:VDBG_06293  -  
Amino Acid Sequences MNKGPQALINLARNTPSARPPKKKSRAIPRLKKTKKKAEEEADPGAAGAGENDEDAGLYADPEKIILREPLSRATAMAWNPNMEFACWAAISLASGLVKVMDLGVDYLPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.36
5 0.43
6 0.52
7 0.6
8 0.7
9 0.77
10 0.83
11 0.85
12 0.85
13 0.86
14 0.88
15 0.9
16 0.89
17 0.9
18 0.91
19 0.91
20 0.89
21 0.89
22 0.87
23 0.84
24 0.83
25 0.79
26 0.76
27 0.71
28 0.65
29 0.54
30 0.45
31 0.36
32 0.27
33 0.19
34 0.12
35 0.06
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.08
54 0.09
55 0.12
56 0.14
57 0.17
58 0.18
59 0.18
60 0.17
61 0.17
62 0.19
63 0.17
64 0.21
65 0.18
66 0.18
67 0.18
68 0.2
69 0.19
70 0.15
71 0.15
72 0.11
73 0.11
74 0.1
75 0.1
76 0.08
77 0.07
78 0.07
79 0.07
80 0.08
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.04
89 0.04
90 0.06