Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SMK3

Protein Details
Accession C9SMK3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-195ELEPVRIKIKKKQRTRRAQRVRSQHRFTTLHydrophilic
NLS Segment(s)
PositionSequence
172-185IKIKKKQRTRRAQR
Subcellular Location(s) mito 19.5, cyto_mito 11, nucl 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG val:VDBG_06127  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MSRALLRSVLELRAPFTRLPPTFLLPIRARAFNTTTPIIEPTQDAIPSQAATTIAQQAAKADPLALYPKQAPATQPAPITDSVRQLLPLLAAQPSHYITFHIHGRPYLVQPGDAIRLPFRMPGVVPGDVLRLDCASVIGSRDFTLKGSPYIDERLFECRAVVTGSELEPVRIKIKKKQRTRRAQRVRSQHRFTTLAVSELRIKGLEEIEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.24
4 0.31
5 0.29
6 0.33
7 0.33
8 0.34
9 0.37
10 0.38
11 0.42
12 0.35
13 0.42
14 0.41
15 0.4
16 0.38
17 0.36
18 0.38
19 0.34
20 0.37
21 0.31
22 0.28
23 0.27
24 0.28
25 0.25
26 0.21
27 0.19
28 0.16
29 0.16
30 0.16
31 0.14
32 0.13
33 0.13
34 0.13
35 0.12
36 0.1
37 0.09
38 0.09
39 0.11
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.13
46 0.13
47 0.11
48 0.08
49 0.07
50 0.09
51 0.13
52 0.12
53 0.13
54 0.13
55 0.16
56 0.18
57 0.19
58 0.18
59 0.2
60 0.22
61 0.22
62 0.22
63 0.2
64 0.2
65 0.21
66 0.23
67 0.19
68 0.19
69 0.17
70 0.16
71 0.16
72 0.14
73 0.13
74 0.1
75 0.09
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.08
84 0.09
85 0.09
86 0.12
87 0.15
88 0.15
89 0.14
90 0.14
91 0.16
92 0.16
93 0.16
94 0.17
95 0.14
96 0.12
97 0.12
98 0.14
99 0.13
100 0.13
101 0.12
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.08
108 0.08
109 0.11
110 0.14
111 0.13
112 0.13
113 0.13
114 0.13
115 0.13
116 0.13
117 0.09
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.06
124 0.07
125 0.07
126 0.08
127 0.08
128 0.09
129 0.1
130 0.1
131 0.11
132 0.11
133 0.12
134 0.13
135 0.13
136 0.15
137 0.19
138 0.19
139 0.18
140 0.18
141 0.22
142 0.22
143 0.21
144 0.19
145 0.14
146 0.14
147 0.14
148 0.13
149 0.1
150 0.1
151 0.1
152 0.14
153 0.13
154 0.14
155 0.14
156 0.16
157 0.19
158 0.23
159 0.26
160 0.32
161 0.43
162 0.52
163 0.61
164 0.71
165 0.76
166 0.83
167 0.91
168 0.93
169 0.94
170 0.94
171 0.92
172 0.92
173 0.93
174 0.92
175 0.88
176 0.82
177 0.77
178 0.69
179 0.61
180 0.58
181 0.48
182 0.42
183 0.35
184 0.33
185 0.32
186 0.3
187 0.3
188 0.22
189 0.21
190 0.2