Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SWJ3

Protein Details
Accession C9SWJ3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-143ASVSSWSRGHRTRRPRRRAAARWRRSGGLHydrophilic
NLS Segment(s)
PositionSequence
122-143RGHRTRRPRRRAAARWRRSGGL
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR025160  AATF  
IPR039223  AATF/Bfr2  
KEGG val:VDBG_09268  -  
Pfam View protein in Pfam  
PF13339  AATF-Che1  
Amino Acid Sequences MPVRATLVPSASASSSASTPDKKRKRDTSTEALWAALQETDARAAKHRRKVLDTWSSKTRNATVEVKSRNLISSQQSLVASLEDQLLNSDRLIKRARTPRSCAPVQVAAKVNEDASVSSWSRGHRTRRPRRRAAARWRRSGGLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.17
5 0.22
6 0.29
7 0.39
8 0.47
9 0.54
10 0.63
11 0.7
12 0.74
13 0.79
14 0.8
15 0.78
16 0.74
17 0.71
18 0.62
19 0.52
20 0.43
21 0.33
22 0.26
23 0.17
24 0.12
25 0.06
26 0.06
27 0.09
28 0.11
29 0.11
30 0.16
31 0.25
32 0.32
33 0.4
34 0.45
35 0.45
36 0.49
37 0.52
38 0.55
39 0.56
40 0.54
41 0.51
42 0.54
43 0.53
44 0.49
45 0.48
46 0.42
47 0.33
48 0.33
49 0.33
50 0.28
51 0.33
52 0.34
53 0.34
54 0.31
55 0.29
56 0.25
57 0.22
58 0.21
59 0.16
60 0.16
61 0.15
62 0.17
63 0.16
64 0.16
65 0.15
66 0.13
67 0.1
68 0.07
69 0.08
70 0.06
71 0.06
72 0.06
73 0.08
74 0.08
75 0.08
76 0.14
77 0.13
78 0.18
79 0.21
80 0.22
81 0.29
82 0.37
83 0.47
84 0.46
85 0.53
86 0.57
87 0.61
88 0.61
89 0.54
90 0.5
91 0.49
92 0.44
93 0.43
94 0.39
95 0.33
96 0.34
97 0.33
98 0.28
99 0.21
100 0.2
101 0.15
102 0.13
103 0.15
104 0.14
105 0.15
106 0.17
107 0.18
108 0.25
109 0.31
110 0.38
111 0.43
112 0.54
113 0.64
114 0.73
115 0.81
116 0.85
117 0.89
118 0.91
119 0.92
120 0.92
121 0.92
122 0.91
123 0.91
124 0.85