Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9S7E7

Protein Details
Accession C9S7E7   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-95ALVLRCKKERWEHKEKRRKREDQYLEVBasic
NLS Segment(s)
PositionSequence
76-88KERWEHKEKRRKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045200  CHIP  
IPR011990  TPR-like_helical_dom_sf  
IPR003613  Ubox_domain  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0000209  P:protein polyubiquitination  
KEGG val:VDBG_01352  -  
Pfam View protein in Pfam  
PF04564  U-box  
PROSITE View protein in PROSITE  
PS51698  U_BOX  
Amino Acid Sequences MARLKLNYWDAVVADCETPRPQRHNMKASYYLAQALVSLQDFDGAITAAMRAHALCIETGDRSLAAVTALVLRCKKERWEHKEKRRKREDQYLEVDVIETMEREKERALAAAESEGERGDVAAEWDAKMTDIRRVFETARARGEQKREVPDWLIDDITFNVFVDPWVTKTGKSYERASIMEHLRRHPSDPLTREPLQLAELRPNLALRQAAEEFLNENGWAADW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.17
5 0.24
6 0.28
7 0.32
8 0.4
9 0.49
10 0.59
11 0.65
12 0.67
13 0.67
14 0.68
15 0.66
16 0.6
17 0.5
18 0.42
19 0.34
20 0.28
21 0.21
22 0.15
23 0.13
24 0.1
25 0.09
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.06
52 0.05
53 0.04
54 0.05
55 0.08
56 0.09
57 0.11
58 0.12
59 0.14
60 0.16
61 0.18
62 0.24
63 0.3
64 0.4
65 0.46
66 0.57
67 0.66
68 0.75
69 0.84
70 0.87
71 0.88
72 0.88
73 0.88
74 0.84
75 0.84
76 0.81
77 0.78
78 0.75
79 0.66
80 0.56
81 0.47
82 0.4
83 0.28
84 0.21
85 0.12
86 0.07
87 0.05
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.09
95 0.1
96 0.08
97 0.08
98 0.08
99 0.08
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.03
108 0.04
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.12
118 0.13
119 0.15
120 0.16
121 0.19
122 0.19
123 0.25
124 0.3
125 0.28
126 0.29
127 0.3
128 0.31
129 0.33
130 0.38
131 0.37
132 0.37
133 0.4
134 0.38
135 0.38
136 0.37
137 0.34
138 0.31
139 0.26
140 0.21
141 0.15
142 0.14
143 0.13
144 0.12
145 0.1
146 0.08
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.08
153 0.12
154 0.13
155 0.13
156 0.16
157 0.23
158 0.27
159 0.3
160 0.32
161 0.33
162 0.37
163 0.37
164 0.37
165 0.37
166 0.38
167 0.4
168 0.4
169 0.39
170 0.43
171 0.43
172 0.44
173 0.43
174 0.44
175 0.46
176 0.48
177 0.51
178 0.51
179 0.51
180 0.5
181 0.45
182 0.39
183 0.33
184 0.32
185 0.26
186 0.27
187 0.26
188 0.26
189 0.26
190 0.26
191 0.24
192 0.23
193 0.23
194 0.16
195 0.21
196 0.21
197 0.21
198 0.21
199 0.21
200 0.19
201 0.18
202 0.18
203 0.12
204 0.11