Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H987

Protein Details
Accession Q2H987   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-164YNPAPKARKRGRPPKSTQSTHydrophilic
NLS Segment(s)
PositionSequence
149-159PKARKRGRPPK
Subcellular Location(s) nucl 18, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MESVLNDTEKRFILAEMIKLSDVDVGVLIHLVKSHDIQPKWMFMQLPGGRNMSQCLHAAEAMFNTPMPPPLISPLKRPSLGELSDYGPNKRQALASPGEVSPRGFPPGPNSQPAPGTQPVNIQPRPNGFPPGLPAPTPSVSATPYNPAPKARKRGRPPKSTQSTWQVSTYQNITPAPHPSSPAFAPQPHSPHLPPPAAQQSPIQGQPDPKRAKKGLPEIAPRPPQGPPTAEPAAMLPGVPGAAMEYQKWREETSRRDYYQLHASEPSPRERPTPFAPILPRPRSPLPPPRELARGASTEPRHFAATPPPSAPEPVRNDSQTTTTGPIQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.24
4 0.25
5 0.24
6 0.23
7 0.23
8 0.18
9 0.15
10 0.11
11 0.09
12 0.07
13 0.07
14 0.08
15 0.08
16 0.06
17 0.07
18 0.08
19 0.09
20 0.11
21 0.18
22 0.26
23 0.26
24 0.33
25 0.35
26 0.39
27 0.39
28 0.41
29 0.34
30 0.27
31 0.37
32 0.35
33 0.36
34 0.34
35 0.35
36 0.33
37 0.33
38 0.35
39 0.26
40 0.24
41 0.21
42 0.2
43 0.18
44 0.18
45 0.18
46 0.16
47 0.15
48 0.13
49 0.12
50 0.11
51 0.1
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.16
58 0.25
59 0.26
60 0.32
61 0.36
62 0.4
63 0.41
64 0.41
65 0.4
66 0.38
67 0.38
68 0.33
69 0.29
70 0.26
71 0.3
72 0.31
73 0.28
74 0.26
75 0.28
76 0.27
77 0.26
78 0.25
79 0.22
80 0.26
81 0.26
82 0.24
83 0.24
84 0.23
85 0.23
86 0.23
87 0.21
88 0.18
89 0.17
90 0.18
91 0.16
92 0.16
93 0.2
94 0.29
95 0.31
96 0.31
97 0.32
98 0.3
99 0.31
100 0.31
101 0.31
102 0.24
103 0.22
104 0.2
105 0.23
106 0.27
107 0.33
108 0.34
109 0.31
110 0.3
111 0.33
112 0.36
113 0.34
114 0.31
115 0.24
116 0.23
117 0.24
118 0.26
119 0.23
120 0.19
121 0.18
122 0.18
123 0.19
124 0.2
125 0.17
126 0.13
127 0.14
128 0.15
129 0.15
130 0.14
131 0.17
132 0.18
133 0.19
134 0.23
135 0.28
136 0.33
137 0.43
138 0.48
139 0.55
140 0.62
141 0.71
142 0.76
143 0.79
144 0.8
145 0.8
146 0.79
147 0.73
148 0.68
149 0.66
150 0.6
151 0.51
152 0.46
153 0.37
154 0.3
155 0.29
156 0.26
157 0.19
158 0.17
159 0.16
160 0.16
161 0.15
162 0.18
163 0.2
164 0.18
165 0.19
166 0.17
167 0.2
168 0.19
169 0.22
170 0.2
171 0.18
172 0.21
173 0.23
174 0.26
175 0.25
176 0.28
177 0.24
178 0.27
179 0.3
180 0.28
181 0.25
182 0.27
183 0.32
184 0.29
185 0.29
186 0.26
187 0.24
188 0.26
189 0.27
190 0.23
191 0.18
192 0.24
193 0.29
194 0.37
195 0.41
196 0.41
197 0.46
198 0.47
199 0.5
200 0.52
201 0.55
202 0.54
203 0.54
204 0.59
205 0.55
206 0.62
207 0.61
208 0.54
209 0.46
210 0.4
211 0.36
212 0.32
213 0.31
214 0.25
215 0.28
216 0.28
217 0.26
218 0.25
219 0.22
220 0.21
221 0.17
222 0.15
223 0.08
224 0.06
225 0.06
226 0.05
227 0.05
228 0.04
229 0.06
230 0.07
231 0.08
232 0.13
233 0.15
234 0.18
235 0.19
236 0.2
237 0.24
238 0.31
239 0.38
240 0.42
241 0.49
242 0.48
243 0.51
244 0.51
245 0.49
246 0.51
247 0.45
248 0.38
249 0.31
250 0.31
251 0.36
252 0.37
253 0.39
254 0.34
255 0.34
256 0.36
257 0.35
258 0.4
259 0.37
260 0.43
261 0.38
262 0.4
263 0.44
264 0.49
265 0.57
266 0.57
267 0.54
268 0.52
269 0.56
270 0.57
271 0.6
272 0.61
273 0.58
274 0.6
275 0.61
276 0.59
277 0.58
278 0.53
279 0.5
280 0.44
281 0.4
282 0.35
283 0.4
284 0.4
285 0.39
286 0.4
287 0.37
288 0.35
289 0.33
290 0.33
291 0.34
292 0.36
293 0.36
294 0.35
295 0.36
296 0.35
297 0.38
298 0.39
299 0.38
300 0.39
301 0.41
302 0.45
303 0.44
304 0.46
305 0.44
306 0.44
307 0.39
308 0.34
309 0.34