Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SWE6

Protein Details
Accession C9SWE6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGRFDHKHKKSRLPTREGAABasic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11.5, cyto_nucl 8.833, cyto_mito 8.166
Family & Domain DBs
KEGG val:VDBG_09221  -  
Amino Acid Sequences MGRFDHKHKKSRLPTREGAAARPSLRSLISAPVGPIHRSNGQDLQRGEGFSIVPSIDSCAGSNPNNPTVGEQRKEHLDMADARSNNNGWIMEDGVGKTRLGIPTSSPAPMARRLSASYRGGRPPVGNPVTASENKMTTRGTLAMSRTTIGSNASATKFQPTLKVGEAERASLGSMKPLPELPAVKHSKGRLNLFTGKKSNFNFQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.76
3 0.77
4 0.68
5 0.61
6 0.55
7 0.5
8 0.43
9 0.38
10 0.34
11 0.26
12 0.25
13 0.23
14 0.19
15 0.19
16 0.19
17 0.18
18 0.18
19 0.21
20 0.23
21 0.23
22 0.23
23 0.22
24 0.25
25 0.26
26 0.29
27 0.32
28 0.34
29 0.39
30 0.38
31 0.38
32 0.35
33 0.34
34 0.3
35 0.23
36 0.19
37 0.13
38 0.14
39 0.09
40 0.07
41 0.07
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.13
48 0.14
49 0.18
50 0.19
51 0.2
52 0.21
53 0.21
54 0.22
55 0.27
56 0.32
57 0.31
58 0.29
59 0.29
60 0.31
61 0.33
62 0.3
63 0.23
64 0.2
65 0.2
66 0.24
67 0.26
68 0.23
69 0.22
70 0.22
71 0.22
72 0.19
73 0.17
74 0.12
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.12
91 0.14
92 0.14
93 0.12
94 0.12
95 0.13
96 0.18
97 0.19
98 0.16
99 0.17
100 0.18
101 0.21
102 0.26
103 0.28
104 0.27
105 0.29
106 0.3
107 0.3
108 0.3
109 0.28
110 0.24
111 0.29
112 0.26
113 0.23
114 0.21
115 0.22
116 0.25
117 0.25
118 0.25
119 0.17
120 0.18
121 0.18
122 0.19
123 0.17
124 0.13
125 0.15
126 0.14
127 0.14
128 0.15
129 0.16
130 0.17
131 0.18
132 0.17
133 0.16
134 0.15
135 0.14
136 0.12
137 0.11
138 0.1
139 0.12
140 0.13
141 0.14
142 0.14
143 0.17
144 0.18
145 0.18
146 0.22
147 0.2
148 0.22
149 0.23
150 0.26
151 0.23
152 0.29
153 0.29
154 0.25
155 0.24
156 0.2
157 0.18
158 0.17
159 0.17
160 0.14
161 0.16
162 0.15
163 0.17
164 0.18
165 0.2
166 0.22
167 0.25
168 0.23
169 0.31
170 0.36
171 0.37
172 0.41
173 0.43
174 0.46
175 0.51
176 0.55
177 0.5
178 0.52
179 0.58
180 0.59
181 0.62
182 0.62
183 0.57
184 0.58
185 0.57