Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SKD0

Protein Details
Accession C9SKD0    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-108VTPQRLQHKRHRLALKRRQSEKVKBasic
NLS Segment(s)
PositionSequence
68-106KGEGKKAYTKAPRIQRLVTPQRLQHKRHRLALKRRQSEK
120-142KRVAEKKAEKADARKRRASSMRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG val:VDBG_05257  -  
Amino Acid Sequences MKLNISYPANGSQKLIDIEDERKLAVFHGEARTWALRSPPTPSVDEFKGYISASTVRKYVIRREVQPKGEGKKAYTKAPRIQRLVTPQRLQHKRHRLALKRRQSEKVKDEANEYAQILAKRVAEKKAEKADARKRRASSMRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.2
4 0.2
5 0.22
6 0.24
7 0.24
8 0.2
9 0.19
10 0.18
11 0.16
12 0.15
13 0.13
14 0.14
15 0.18
16 0.18
17 0.18
18 0.22
19 0.23
20 0.21
21 0.21
22 0.19
23 0.18
24 0.19
25 0.24
26 0.25
27 0.26
28 0.28
29 0.28
30 0.3
31 0.29
32 0.29
33 0.24
34 0.2
35 0.19
36 0.17
37 0.16
38 0.12
39 0.15
40 0.15
41 0.15
42 0.15
43 0.14
44 0.17
45 0.19
46 0.25
47 0.29
48 0.32
49 0.37
50 0.44
51 0.5
52 0.49
53 0.51
54 0.49
55 0.44
56 0.45
57 0.4
58 0.34
59 0.36
60 0.36
61 0.39
62 0.4
63 0.42
64 0.44
65 0.52
66 0.57
67 0.51
68 0.51
69 0.48
70 0.52
71 0.55
72 0.54
73 0.49
74 0.47
75 0.54
76 0.59
77 0.6
78 0.61
79 0.63
80 0.63
81 0.68
82 0.73
83 0.73
84 0.77
85 0.82
86 0.83
87 0.81
88 0.81
89 0.81
90 0.79
91 0.78
92 0.73
93 0.71
94 0.65
95 0.56
96 0.55
97 0.49
98 0.44
99 0.37
100 0.32
101 0.25
102 0.24
103 0.23
104 0.21
105 0.2
106 0.19
107 0.22
108 0.25
109 0.28
110 0.32
111 0.36
112 0.43
113 0.5
114 0.55
115 0.55
116 0.62
117 0.68
118 0.71
119 0.74
120 0.74
121 0.68
122 0.7