Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SEW2

Protein Details
Accession C9SEW2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-42GGCKLCKLRRIKCDEAKPFCMKCKKAKRDCPGYSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG val:VDBG_03857  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MVNTGKPSGGCKLCKLRRIKCDEAKPFCMKCKKAKRDCPGYSDPFEAKIRDQTQATIRRFRKMRGDTTGAESRISLPQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.64
4 0.67
5 0.73
6 0.76
7 0.74
8 0.78
9 0.81
10 0.78
11 0.76
12 0.73
13 0.67
14 0.65
15 0.64
16 0.58
17 0.58
18 0.62
19 0.66
20 0.69
21 0.77
22 0.78
23 0.8
24 0.79
25 0.76
26 0.71
27 0.65
28 0.57
29 0.5
30 0.42
31 0.35
32 0.33
33 0.27
34 0.21
35 0.24
36 0.24
37 0.24
38 0.24
39 0.23
40 0.3
41 0.38
42 0.4
43 0.43
44 0.43
45 0.49
46 0.51
47 0.52
48 0.55
49 0.52
50 0.56
51 0.54
52 0.58
53 0.51
54 0.57
55 0.59
56 0.49
57 0.43
58 0.36
59 0.31